Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: debha-q6biq7

Debaryomyces hansenii (Yeast) (Torulaspora hansenii) hansenii

Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Debaryomyces hansenii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Debaryomyces: N E > Debaryomyces hansenii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CR382139
1 UniProt : Q6BIQ7
1 UniProt : Q6BIQ7
1 Interpro : Q6BIQ7
1 Pfam : Q6BIQ7
1 PIRSF : Q6BIQ7
1 SUPERFAM : Q6BIQ7
Sequence
Graphical view for this peptide sequence: debha-q6biq7
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MLSTKNLLKIHVNQIRFASFKVPKSYVPSKLNRHIPFKLALSIWYQSLKP
GRLQTLQDELTELMLPTELNSHLVKENKKVRIDNDGNYLNELSFEINNNS
DKPTKHVVFIHGYGASLGCFARNYQIINSLQDRRYNYKVHFLDNISFGLS
SNPKITSSLINGRIPTCPSVKMYDPEPTTKENVYNKYYKLIESYEINKEE
FQEYQDKFIPILNEMEKYYIEAIENWRIESKIDKIDYLVGHSFGGYWTSS
YAVKYPQNLSNLILLSPVGVERHVHAVTNPIDEIKTQPIKPSVDPTSYHF
LTRMPMLTGKHVINWYTVLPYLPKLLRWLGPWGVSRYYKERYGKLFKVNK
VTSQLGGASEVFQHENDLIIGTNKECYLLFEYLYNSTTIGSQSDIYIKYL
LTPCTVSKWPLYDKFTNFFKNSPTSEFRIHFVYGEYDFMNSEAGLKLAEK
INHLSESPIADFHKIPQGGHNMYLDNPFDTNKMLHNIIQKQDDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLSTKNLLKIHVNQIRFASFKVPKSYVPSKLNRHIPFKLALSIWYQSLKP
GRLQTLQDELTELMLPTELNSHLVKENKKVRIDNDGNYLNELSFEINNNS
DKPTKHVVFIHGYGASLGCFARNYQIINSLQDRRYNYKVHFLDNISFGLS
SNPKITSSLINGRIPTCPSVKMYDPEPTTKENVYNKYYKLIESYEINKEE
FQEYQDKFIPILNEMEKYYIEAIENWRIESKIDKIDYLVGHSFGGYWTSS
YAVKYPQNLSNLILLSPVGVERHVHAVTNPIDEIKTQPIKPSVDPTSYHF
LTRMPMLTGKHVINWYTVLPYLPKLLRWLGPWGVSRYYKERYGKLFKVNK
VTSQLGGASEVFQHENDLIIGTNKECYLLFEYLYNSTTIGSQSDIYIKYL
LTPCTVSKWPLYDKFTNFFKNSPTSEFRIHFVYGEYDFMNSEAGLKLAEK
INHLSESPIADFHKIPQGGHNMYLDNPFDTNKMLHNIIQKQDDL


Reference
    Title: Genome evolution in yeasts
    Dujon B, Sherman D, Fischer G, Durrens P, Casaregola S, Lafontaine I, De Montigny J, Marck C, Neuveglise C and Souciet JL <57 more author(s)>
    Ref: Nature, 430:35, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer