Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: culqu-b0xfi2

Culex quinquefasciatus (Southern house mosquito) esterase

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Culex quinquefasciatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Culicini: N E > Culex [genus]: N E > Culex [subgenus]: N E > Culex pipiens complex: N E > Culex quinquefasciatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Permethrin
No inhibitor
1 Genbank : DS232930
1 UniProt : B0XFI2
1 UniProt : B0XFI2
1 Interpro : B0XFI2
1 Pfam : B0XFI2
1 PIRSF : B0XFI2
1 SUPERFAM : B0XFI2
Sequence
Graphical view for this peptide sequence: culqu-b0xfi2
Colored MSA for Carb_B_Arthropoda (raw)
MFKSATLLLVALATASAQDASRPIITTTGGQVQGITASCGLFCSYFQFNG
IPYAEPPVGDLRFRNPVPHRGWSGVRDASDHGQSCPSLSPLSEYSGGEDC
LFINVYSQNLIGSRPVMVWIHGGAFVLGNGDSRIYGPDHLVQENVVVVSF
NYRLGILGFFSTGDTQAQGNWGLKDCVEALRWVRANIAAFGGDPNNVTIF
GESAGGVMVHFMTLSPMTAGLFHKAIAQSGTALVPWGFQYNPREMSRQIA
DAFGYPHDTAELTRLLRYTPIAEFVALQRGITDIPIPRGFKPFEYVPSAE
PVNSPEPTFITQRPIEILLSGAYNHVPIMFGHTNAESLFMVREHAVDSTV
WNEFTRNPGFFVPHFWNIPAGTSEASAVSQAFRNFYWQDRPLGPAINLEW
TTFHTDQQFIYAIDKTVRLTADRSPQSTYYYQFSFDGDLNLIKRLLLLTD
FPGAVHADELPYLFSMSNLPVTPILPSNHANVVRQRMVRLWTNFAITGRP
TPNSDTALQNIQWAPVQGGNMAYLDIGHDLVPGNNPNQARIALWKDLEDR
YANDPFFYPYQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFKSATLLLVALATASAQDASRPIITTTGGQVQGITASCGLFCSYFQFNG
IPYAEPPVGDLRFRNPVPHRGWSGVRDASDHGQSCPSLSPLSEYSGGEDC
LFINVYSQNLIGSRPVMVWIHGGAFVLGNGDSRIYGPDHLVQENVVVVSF
NYRLGILGFFSTGDTQAQGNWGLKDCVEALRWVRANIAAFGGDPNNVTIF
GESAGGVMVHFMTLSPMTAGLFHKAIAQSGTALVPWGFQYNPREMSRQIA
DAFGYPHDTAELTRLLRYTPIAEFVALQRGITDIPIPRGFKPFEYVPSAE
PVNSPEPTFITQRPIEILLSGAYNHVPIMFGHTNAESLFMVREHAVDSTV
WNEFTRNPGFFVPHFWNIPAGTSEASAVSQAFRNFYWQDRPLGPAINLEW
TTFHTDQQFIYAIDKTVRLTADRSPQSTYYYQFSFDGDLNLIKRLLLLTD
FPGAVHADELPYLFSMSNLPVTPILPSNHANVVRQRMVRLWTNFAITGRP
TPNSDTALQNIQWAPVQGGNMAYLDIGHDLVPGNNPNQARIALWKDLEDR
YANDPFFYPYQ


Reference
    Title: Molecular and functional characterization of three novel carboxylesterases in the detoxification of permethrin in the mosquito, Culex quinquefasciatus
    Gong Y, Li M, Li T, Liu N
    Ref: Insect Sci, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer