Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cordi-q6nes6

Corynebacterium diphtheriae Envelope lipids regulation factor

Comment
Other strains: Corynebacterium diphtheriae (strains BH8; HC04; HC03; VA01; ATCC 27012 / C7 (beta); INCA 402; 241; HC01; CDCE 8392; PW8; HC02; 31A)


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Corynebacterium diphtheriae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium diphtheriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 10 more: BX248360, CP003209, CP003215
1 UniProt : Q6NES6
1 UniProt : Q6NES6
1 Interpro : Q6NES6
1 Pfam : Q6NES6
1 PIRSF : Q6NES6
1 SUPERFAM : Q6NES6
Sequence
Graphical view for this peptide sequence: cordi-q6nes6
Colored MSA for Cutinase (raw)
MKKLLTVVATVVVLVIILAGVVRWMNTSSDEQPGSPAAPSSSEQPSQPDS
CPAVEVISAPGTWESARDDDPLNPMANPASFMLSISRPLQEQYAGDVLVW
TLPYTAQFRNINSQEEMSYDESRQEGTSTLEGELVRMHKECPQTDFVMAG
FSQGAVIVGDIANRIGTGAGVIPAERVRGVALIADGRREPGVGQAVGNPV
AGVGAEIALQPLNLLVQPIVPGATMRGPRVGGFGELDAKTVEICAPDDTI
CDAPRDVGNALARAQALVEANGVHALYATNPNVFPGTTTNQWVVDWIKGL
IDG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKLLTVVATVVVLVIILAGVVRWMNTSSDEQPGSPAAPSSSEQPSQPDS
CPAVEVISAPGTWESARDDDPLNPMANPASFMLSISRPLQEQYAGDVLVW
TLPYTAQFRNINSQEEMSYDESRQEGTSTLEGELVRMHKECPQTDFVMAG
FSQGAVIVGDIANRIGTGAGVIPAERVRGVALIADGRREPGVGQAVGNPV
AGVGAEIALQPLNLLVQPIVPGATMRGPRVGGFGELDAKTVEICAPDDTI
CDAPRDVGNALARAQALVEANGVHALYATNPNVFPGTTTNQWVVDWIKGL
IDG


References
    Title: Pangenomic study of Corynebacterium diphtheriae that provides insights into the genomic diversity of pathogenic isolates from cases of classical diphtheria, endocarditis, and pneumonia
    Trost E, Blom J, Soares Sde C, Huang IH, Al-Dilaimi A, Schroder J, Jaenicke S, Dorella FA, Rocha FS and Tauch A <13 more author(s)>
    Ref: Journal of Bacteriology, 194:3199, 2012 : PubMed

            

    Title: The complete genome sequence and analysis of Corynebacterium diphtheriae NCTC13129
    Cerdeno-Tarraga AM, Efstratiou A, Dover LG, Holden MT, Pallen M, Bentley SD, Besra GS, Churcher C, James KD and Parkhill J <16 more author(s)>
    Ref: Nucleic Acids Research, 31:6516, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer