Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: copc7-d6rnh7

Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cacap fungus) (Hormographiella aspergillata) Putative uncharacterized protein

Comment
only n-term ab-hydrolase


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Coprinopsis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AACS02000007
1 UniProt : D6RNH7
1 UniProt : D6RNH7
1 Interpro : D6RNH7
1 Pfam : D6RNH7
1 PIRSF : D6RNH7
1 SUPERFAM : D6RNH7
Sequence
Graphical view for this peptide sequence: copc7-d6rnh7
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MVDLKHTQEQLELAPQRVTVETRYGPVTGGRAANGAAVFLEIPYAVPPKR
FEDPQPLPDTFRYPDQKEYIVESAYAAQPRNDGQAAAMDFKAKVGLGAPT
ENPLFLNIYVPPSYPSKRNFPVKVYIHGGFLQFGSPHGLSAQAQYAAAER
EEIWVNIGYRLSAFGFIASAKNGLTGNYGFKDQWLALKWIKANISAFGGN
QDDIQLTGLSAGAHSVHQILHHLSVLPPGENAPFSSAVLQSNAMPTDPKT
SAQLDPQFDALCKALGLDPDSPDILETLKDDTKVPASRITEVIEEEKLGR
YGAFRGCLSDDWIITSPGPMERQHNGSFATSLRERGVKYIVVGEVSEEWY
LYSIAHPISSPADITFQLERYFTPEFVSELVGHYPPLPSETSEAELLRRF
GDVFSLAQVYLPVRVLARDLVARGFPVLRYRISWGPEHGCLPHKGLVTHG
TDRALWTLCFPALTDTEASVARSWVGRVEKEVENALNGHSRAADEVLLLD
EEQNIGWAKDPLWEELSGLANKILPSTASL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVDLKHTQEQLELAPQRVTVETRYGPVTGGRAANGAAVFLEIPYAVPPKR
FEDPQPLPDTFRYPDQKEYIVESAYAAQPRNDGQAAAMDFKAKVGLGAPT
ENPLFLNIYVPPSYPSKRNFPVKVYIHGGFLQFGSPHGLSAQAQYAAAER
EEIWVNIGYRLSAFGFIASAKNGLTGNYGFKDQWLALKWIKANISAFGGN
QDDIQLTGLSAGAHSVHQILHHLSVLPPGENAPFSSAVLQSNAMPTDPKT
SAQLDPQFDALCKALGLDPDSPDILETLKDDTKVPASRITEVIEEEKLGR
YGAFRGCLSDDWIITSPGPMERQHNGSFATSLRERGVKYIVVGEVSEEWY
LYSIAHPISSPADITFQLERYFTPEFVSELVGHYPPLPSETSEAELLRRF
GDVFSLAQVYLPVRVLARDLVARGFPVLRYRISWGPEHGCLPHKGLVTHG
TDRALWTLCFPALTDTEASVARSWVGRVEKEVENALNGHSRAADEVLLLD
EEQNIGWAKDPLWEELSGLANKILPSTASL


Reference
    Title: Insights into evolution of multicellular fungi from the assembled chromosomes of the mushroom Coprinopsis cinerea (Coprinus cinereus)
    Stajich JE, Wilke SK, Ahren D, Au CH, Birren BW, Borodovsky M, Burns C, Canback B, Casselton LA and Pukkila PJ <39 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:11889, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer