Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: copc7-a8nzs7

Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata). Fungal cellulose binding domain-containing protein

Comment
c-term CBM1 Cellulose-binding protein excluded. Other strains: Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus)


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Coprinopsis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AACS02000006, XP_001837739, XP_001837739.1
1 UniProt : A8NZS7
2 UniProt : A8NZS7, D7URW8
2 Interpro : A8NZS7, D7URW8
2 Pfam : A8NZS7, D7URW8
2 PIRSF : A8NZS7, D7URW8
2 SUPERFAM : A8NZS7, D7URW8
Sequence
Graphical view for this peptide sequence: copc7-a8nzs7
Colored MSA for FaeC (raw)
MRAVTAFFLLLAATLQGVIAASTPGCGRSPPSSGTKNIGNRQYILQVPAN
YDPNRPYKLIFGFHWLGGNMNNVAPGYYGLRALANESAIFVAPNGLDAGW
ANTGGRDTTFVNQMLTELKNSMCVDDTQIFATGFSYGGGMSYSLACSNPR
DFRAVSVIAGAQLSGCSGGETRVAYLGIHGVVDSVLNVSAGRQLRDRYLR
VNGCQSKNAPEPPRGPDSNYMKTEYSCAAGYPVWWIAHGGDHVAQPSGQN
WMATQTWDFWT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRAVTAFFLLLAATLQGVIAASTPGCGRSPPSSGTKNIGNRQYILQVPAN
YDPNRPYKLIFGFHWLGGNMNNVAPGYYGLRALANESAIFVAPNGLDAGW
ANTGGRDTTFVNQMLTELKNSMCVDDTQIFATGFSYGGGMSYSLACSNPR
DFRAVSVIAGAQLSGCSGGETRVAYLGIHGVVDSVLNVSAGRQLRDRYLR
VNGCQSKNAPEPPRGPDSNYMKTEYSCAAGYPVWWIAHGGDHVAQPSGQN
WMATQTWDFWT


Reference
    Title: Insights into evolution of multicellular fungi from the assembled chromosomes of the mushroom Coprinopsis cinerea (Coprinus cinereus)
    Stajich JE, Wilke SK, Ahren D, Au CH, Birren BW, Borodovsky M, Burns C, Canback B, Casselton LA and Pukkila PJ <39 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:11889, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer