Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: copc7-a8nwm2

Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky can fungus) (Hormographiella aspergillata) Abhydrolase domain-containing protein 4

Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Coprinopsis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AACS02000005
1 UniProt : A8NWM2
1 UniProt : A8NWM2
1 Interpro : A8NWM2
1 Pfam : A8NWM2
1 PIRSF : A8NWM2
1 SUPERFAM : A8NWM2
Sequence
Graphical view for this peptide sequence: copc7-a8nwm2
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MASSSTSSLPTYQVLDSLPPSAPSIPSGFTQSVRSWWSNVGFKQSQTAEL
RILLRVPYFSKYSKPPSTTPNAPLTVSSSLVPLSTPKHYINTLAMTSTDP
DTSDTAPPPAVLLHGYGAGLGFFFRNFPTLAHWAEKRRSSVFAIDWLGMG
RSARVPFTVKAKRSSVKERVEEAEAFFIDSLEDWRKQMGLERMTLIGHSL
GAYLSVAYTLKFPERVAKLVLLSPAGVPRGPNFTEVSRELTDHGADPEGE
HHSHPERDPTKAEPASQGRVSSLRSSQKRHSHQTNQSFSRRIFSYLWEEG
FSPFQVVRSTLFWGPWLVGKYSSRRFQGLTEEDTRDLHDYILNITFAKGS
GEYCISHLLEPGAHARMPIVDRIAGVKVPVTFVYGDHDWMDPVGGMQSVE
KLRQAGNGEGKMYIVNNAGHHLYLDNPDAVNALLLKELDKQHRNLHNHPA
HHRNSQTSGDSSSSTGPSYHDFY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASSSTSSLPTYQVLDSLPPSAPSIPSGFTQSVRSWWSNVGFKQSQTAEL
RILLRVPYFSKYSKPPSTTPNAPLTVSSSLVPLSTPKHYINTLAMTSTDP
DTSDTAPPPAVLLHGYGAGLGFFFRNFPTLAHWAEKRRSSVFAIDWLGMG
RSARVPFTVKAKRSSVKERVEEAEAFFIDSLEDWRKQMGLERMTLIGHSL
GAYLSVAYTLKFPERVAKLVLLSPAGVPRGPNFTEVSRELTDHGADPEGE
HHSHPERDPTKAEPASQGRVSSLRSSQKRHSHQTNQSFSRRIFSYLWEEG
FSPFQVVRSTLFWGPWLVGKYSSRRFQGLTEEDTRDLHDYILNITFAKGS
GEYCISHLLEPGAHARMPIVDRIAGVKVPVTFVYGDHDWMDPVGGMQSVE
KLRQAGNGEGKMYIVNNAGHHLYLDNPDAVNALLLKELDKQHRNLHNHPA
HHRNSQTSGDSSSSTGPSYHDFY


Reference
    Title: Insights into evolution of multicellular fungi from the assembled chromosomes of the mushroom Coprinopsis cinerea (Coprinus cinereus)
    Stajich JE, Wilke SK, Ahren D, Au CH, Birren BW, Borodovsky M, Burns C, Canback B, Casselton LA and Pukkila PJ <39 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 107:11889, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer