Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: copc7-a8nll9

Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Cip2

Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|Coprinopsis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_001834722.2
1 UniProt : A8NLL9
1 Interpro : A8NLL9
1 Pfam : A8NLL9
1 PIRSF : A8NLL9
1 SUPERFAM : A8NLL9
Sequence
Graphical view for this peptide sequence: copc7-a8nll9
Colored MSA for Glucuronoyl_esterase (raw)
MKILTPAFASLLTALLASAQSTAPSAPQPETKCPAFPDRLILSKLPDPFT
FFNGKKVRTKDDWACRRAEISALLQRFELGDLPGKPDKVVGVIDENHRSI
TVNVTVGDREISFTSTIRLPEPVKPEPEPSPEPEPEEPEEPSPEPEEPVP
EPEEPEPTPEPEDPDSVSTPKKKYPAIISLGYASIPAPEGVAVISLNNDL
IAEQQGRTRSRGKGLFYDLYGADHSAGAMLAWTWGVSRLIDALESAQGSQ
IDTKRLAVTGCSRNGKGTHVVGAFEERIALTIPQEPGTGGAGCWRIADQL
RDEGLTVQTGSQIITENVWFSTRFDEYANKTGVLPFDHHFLSAMVAPRGL
LVLEHSGIDWLGPESTYGCVSAARKVWQALGAQRNVGFLQAGEHNHCQFP
ESQRKDLEAYFDRFLKGKRAETGHFKTDGEFEWDESEWIDWETPRLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKILTPAFASLLTALLASAQSTAPSAPQPETKCPAFPDRLILSKLPDPFT
FFNGKKVRTKDDWACRRAEISALLQRFELGDLPGKPDKVVGVIDENHRSI
TVNVTVGDREISFTSTIRLPEPVKPEPEPSPEPEPEEPEEPSPEPEEPVP
EPEEPEPTPEPEDPDSVSTPKKKYPAIISLGYASIPAPEGVAVISLNNDL
IAEQQGRTRSRGKGLFYDLYGADHSAGAMLAWTWGVSRLIDALESAQGSQ
IDTKRLAVTGCSRNGKGTHVVGAFEERIALTIPQEPGTGGAGCWRIADQL
RDEGLTVQTGSQIITENVWFSTRFDEYANKTGVLPFDHHFLSAMVAPRGL
LVLEHSGIDWLGPESTYGCVSAARKVWQALGAQRNVGFLQAGEHNHCQFP
ESQRKDLEAYFDRFLKGKRAETGHFKTDGEFEWDESEWIDWETPRLR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer