Gene_locus Report for: copc7-a8nb00.6Coprinopsis cinerea (Hormographiella aspergillata) Cip2 Comment Other strains: Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) 10 genes concatened (2 fragments) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetidae: N E > Agaricales: N E > Psathyrellaceae: N E > Coprinopsis: N E > Coprinopsis cinerea: N E
6_AlphaBeta_hydrolase : copc7-a8p0p4Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein. A85-EsteraseD-FGH : copc7-a8n2b8Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Esterase D. Acetylxylan_esterase : copc7-a8nq30Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata) Cutinase. Acidic_Lipase : copc7-a8n6a5Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Triacylglycerol lipase. Carboxypeptidase_S10 : copc7-a8n941Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, copc7-kex1Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Carboxypeptidase D. CGI-58_ABHD5_ABHD4 : copc7-a8nwm2Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky can fungus) (Hormographiella aspergillata) Abhydrolase domain-containing protein 4. Cutinase : copci-b9u444Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata) Cutinase, copc7-a8nb05Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Triacylglycerol lipase, copc7-a8nha0Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Cutinase, copci-b9u443Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata) Cutinase CcCut, copc7-a8nh79Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Cutinase. DPP4N_Peptidase_S9 : copc7-a8n8h4Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Dipeptidyl-peptidase and tripeptidyl-peptidase. Duf_726 : copc7-a8n3x4Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, copc7-a8ner2Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) DUF726 domain-containing protein. Epoxide_hydrolase : copc7-a8n3e0Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, copc7-a8n3e1Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, copc7-a8nqv8Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein. Esterase_phb : copc7-axe1Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata). Acetylxylan esterase. FaeC : copc7-a8nzs7Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata). Fungal cellulose binding domain-containing protein. Fungal_carboxylesterase_lipase : copc7-a8n3l7Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8n4l7Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8n596Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8nc68Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8ncq6Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8ncq7Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8ncr0Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8nei8Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8niw4Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8nql9Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8nuu9Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8p0k3Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8pag1Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8pag3Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-a8pch2Coprinopsis cinerea (Hormographiella aspergillata) (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) Putative uncharacterized protein, copc7-d6rnh7Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cacap fungus) (Hormographiella aspergillata) Putative uncharacterized protein. Glucuronoyl_esterase : copc7-a8nll5Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Cip2, copc7-a8nll6Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Cip2, copc7-a8nll9Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Cip2, copc7-a8nb00.1Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.2Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.3Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.4Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.5Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.7Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nb00.10Coprinopsis cinerea (Hormographiella aspergillata) Cip2, copc7-a8nlk5Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata) Cip2. Hormone-sensitive_lipase_like : copc7-a8nqf4Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein. LIDHydrolase : copc7-a8n2c2Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky ca fungus) (Hormographiella aspergillata) Predicted protein. Monoglyceridelipase_lysophospholip : copc7-a8n702Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein. PMH_Peptidase_S9 : copc7-d6rlx1Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Peptidase. PPase_methylesterase_euk : copc7-a8nvb5Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Protein phosphatase methylesterase 1. Proline_iminopeptidase : copc7-d6rm78Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata). Proline iminopeptidase. Prolylcarboxypeptidase : copc7-a8nqg3Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein, copc7-a8nz18Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGS 9003) (Inky cap fungus) (Hormographiella aspergillata) Endoprotease. Steryl_acetyl_hydrolase : copc7-a8nkc7Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata) Putative uncharacterized protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: copc7-a8nb00.6 Colored MSA for Glucuronoyl_esterase (raw)
PAELNLSAVDRLNNPFAFVNGSKNVEDVNDWYCRRQEIGNLFQRLELGYV
PAQPSTVTGSLSGNSLTVTVGHEGRTTSFTANITYPQGNGPFAAIIGIGG
STVPNPPEVAVITFNNQEIAVDNGVAGRGQGKFYDLYGTGHTAGSLVAWS
WAVSRIIDALQSTQNTRIDVGKLAVTGCSAAGKAALVAGAFEQRLSLTIP
VESGIGGAGCWRVAEELRRGGAAIVTAGELANTTSYYSRDFNPFAANINT
LPFDHHLLAAMVAPRGLLVLDNSQYSWLGPQSVYGCMVTANKVYQALGIR
DRLGVSIVGGHDHCVFPGQQYPEFQAFINKFLRGITSENTNVIKTDQPNN
GGWNESRWVDWTVPTL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
PAELNLSAVDRLNNPFAFVNGSKNVEDVNDWYCRRQEIGNLFQRLELGYV PAQPSTVTGSLSGNSLTVTVGHEGRTTSFTANITYPQGNGPFAAIIGIGG STVPNPPEVAVITFNNQEIAVDNGVAGRGQGKFYDLYGTGHTAGSLVAWS WAVSRIIDALQSTQNTRIDVGKLAVTGCSAAGKAALVAGAFEQRLSLTIP VESGIGGAGCWRVAEELRRGGAAIVTAGELANTTSYYSRDFNPFAANINT LPFDHHLLAAMVAPRGLLVLDNSQYSWLGPQSVYGCMVTANKVYQALGIR DRLGVSIVGGHDHCVFPGQQYPEFQAFINKFLRGITSENTNVIKTDQPNN GGWNESRWVDWTVPTL
|
|
|