Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cofca-a0a068u1v4.1

Coffea canephora (Robusta coffee). Uncharacterized protein

Comment
Two genes concatened. The second only fragment


Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Coffea canephora
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Gentianales: N E > Rubiaceae: N E > Ixoroideae: N E > Gardenieae complex: N E > Bertiereae - Coffeeae clade: N E > Coffeeae: N E > Coffea: N E > Coffea canephora: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HG739092
1 UniProt : A0A068U1V4
1 UniProt : A0A068U1V4
1 Interpro : A0A068U1V4
1 Pfam : A0A068U1V4
1 PIRSF : A0A068U1V4
1 SUPERFAM : A0A068U1V4
Sequence
Graphical view for this peptide sequence: cofca-a0a068u1v4.1
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MACNKSFCSNYMLLSPEKAGLVDLVCFLFSSNIYNRKFVDVPKGTKMPFA
PRWIIFLTVVAQILLRLVAKPVAWLGNLLEQWLNLLHMNTNIFVLIYNLV
TGQVIGIPDETSAKYLSVLAFLDLRQDLDENIAAGDSRYNPHLSIMAAKV
AYENKAFIESTVTDHWKMDFVAFYDFWNDYQKKATTQGFLFRKDENTDTE
TIVVAFRGTSPFDTLDWVSDVDLSWYEFPGLGKVHAGFLKALGQQKLTGW
PKNLIQIFGGHDYAYYTVRGKLKELLKKNDKAKFIVTGHSLGGALAILFP
AILAYHGETSMLERLDGVYTFGQPRVGNEQFGKFMEDQINNNLLPNYYRT
VYCNDIVPRVPSDNSVTEFKHFGTCAYFNSFFKGKTVDEAPNKNYFSILW
LIPKIINSIWELIRSFIKGCVWGSDYKETGLMQLLRVVCLLFGGVPAHCP
PDYVDSTRLASTELYGTG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MACNKSFCSNYMLLSPEKAGLVDLVCFLFSSNIYNRKFVDVPKGTKMPFA
PRWIIFLTVVAQILLRLVAKPVAWLGNLLEQWLNLLHMNTNIFVLIYNLV
TGQVIGIPDETSAKYLSVLAFLDLRQDLDENIAAGDSRYNPHLSIMAAKV
AYENKAFIESTVTDHWKMDFVAFYDFWNDYQKKATTQGFLFRKDENTDTE
TIVVAFRGTSPFDTLDWVSDVDLSWYEFPGLGKVHAGFLKALGQQKLTGW
PKNLIQIFGGHDYAYYTVRGKLKELLKKNDKAKFIVTGHSLGGALAILFP
AILAYHGETSMLERLDGVYTFGQPRVGNEQFGKFMEDQINNNLLPNYYRT
VYCNDIVPRVPSDNSVTEFKHFGTCAYFNSFFKGKTVDEAPNKNYFSILW
LIPKIINSIWELIRSFIKGCVWGSDYKETGLMQLLRVVCLLFGGVPAHCP
PDYVDSTRLASTELYGTG


Reference
    Title: The coffee genome provides insight into the convergent evolution of caffeine biosynthesis
    Denoeud F, Carretero-Paulet L, Dereeper A, Droc G, Guyot R, Pietrella M, Zheng C, Alberti A, Anthony F and Lashermes P <54 more author(s)>
    Ref: Science, 345:1181, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer