Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: clams-b0rcr0

Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / JC9667 subsp. michiganensis (strain NCPPB 382) Putative uncharacterized protein

Relationship
Family|A85-Est-Putative
Block| X
Position in NCBI Life Tree|Clavibacter michiganensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Microbacteriaceae: N E > Clavibacter: N E > Clavibacter michiganensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AM849034, AM711867
2 UniProt : B0RCR0, A5CRB6
2 UniProt : B0RCR0, A5CRB6
2 Interpro : B0RCR0, A5CRB6
2 Pfam : B0RCR0, A5CRB6
2 PIRSF : B0RCR0, A5CRB6
2 SUPERFAM : B0RCR0, A5CRB6
Sequence
Graphical view for this peptide sequence: clams-b0rcr0
Colored MSA for A85-Est-Putative (raw)
MLHDLADLPIISASFVTASTVVPIVGLALLLLIARRARIRTGARAAAPRR
AARAILIGAVAGGLAGLALTWVLGDLLDLFGVILSVPTRVWTALGGLGLG
VAGVVVARSRSAVTGVGGRGAPPRGLRILHTVLAVLIAPLVVFATAIGIN
ADLQEYPNIAAAFGISRISPLDVSALPAPDAAGAPVDAASTAPVAETWRA
SENLPARGRVGSVTIPGTQSGFAARDGLVYLPPAALVSDAPALPVVVAMS
GQPGSPLDLIASGRVDRVLDEYAAANGGLAPIVVIPDHLGAQDANPMCVD
SPLGNTSTYLTVDVPAWITAHLRVLPGADRWTILGFSQGGTCAAQIGSAR
PDLFGTIVDISGEVAPTRGGDTVAAAFGGSQARYAAAFPAAIMESRAPYP
DSTAFFCVGEVDQQYRPEVEQIEAAAKAAGMDTRMSTAPGRAHDWGAVNT
CVHGILPPLGQRLGLTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHDLADLPIISASFVTASTVVPIVGLALLLLIARRARIRTGARAAAPRR
AARAILIGAVAGGLAGLALTWVLGDLLDLFGVILSVPTRVWTALGGLGLG
VAGVVVARSRSAVTGVGGRGAPPRGLRILHTVLAVLIAPLVVFATAIGIN
ADLQEYPNIAAAFGISRISPLDVSALPAPDAAGAPVDAASTAPVAETWRA
SENLPARGRVGSVTIPGTQSGFAARDGLVYLPPAALVSDAPALPVVVAMS
GQPGSPLDLIASGRVDRVLDEYAAANGGLAPIVVIPDHLGAQDANPMCVD
SPLGNTSTYLTVDVPAWITAHLRVLPGADRWTILGFSQGGTCAAQIGSAR
PDLFGTIVDISGEVAPTRGGDTVAAAFGGSQARYAAAFPAAIMESRAPYP
DSTAFFCVGEVDQQYRPEVEQIEAAAKAAGMDTRMSTAPGRAHDWGAVNT
CVHGILPPLGQRLGLTR


References
    Title: Genome of the actinomycete plant pathogen Clavibacter michiganensis subsp. sepedonicus suggests recent niche adaptation
    Bentley SD, Corton C, Brown SE, Barron A, Clark L, Doggett J, Harris B, Ormond D, Quail MA and Ishimaru CA <4 more author(s)>
    Ref: Journal of Bacteriology, 190:2150, 2008 : PubMed

            

    Title: The genome sequence of the tomato-pathogenic actinomycete Clavibacter michiganensis subsp. michiganensis NCPPB382 reveals a large island involved in pathogenicity
    Gartemann KH, Abt B, Bekel T, Burger A, Engemann J, Flugel M, Gaigalat L, Goesmann A, Grafen I and Bartels D <14 more author(s)>
    Ref: Journal of Bacteriology, 190:2138, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer