Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cerui-gce

Cerrena unicolor (Canker rot fungus) (Daedalea unicolor) 4-O-methyl-glucuronoyl methylesterase ; EC=3.1.1.- Glucuronoyl esterase

Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|Cerrena unicolor
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Agaricomycotina: N E > Agaricomycetes: N E > Agaricomycetes incertae sedis: N E > Polyporales: N E > Cerrenaceae: N E > Cerrena: N E > Cerrena unicolor: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 6RTV, 6RU1, 6RU2... more)
No kinetic





5 substrates (e.g. : MeGlcA2, MeMeGlcA, O-AMX... more)
No inhibitor
2 Genbank : AIY68500, KM875459
>3 Structure links 3 more: 6RTV, 6RU2, 6RU1
1 UniProt : A0A0A7EQR3
1 Interpro : A0A0A7EQR3
1 Pfam : A0A0A7EQR3
1 PIRSF : A0A0A7EQR3
1 SUPERFAM : A0A0A7EQR3
Sequence
Graphical view for this peptide sequence: cerui-gce
Colored MSA for Glucuronoyl_esterase (raw)
MFKPSFVALALVSYATAQASAPQWGQCGGIGWTGPTACPSGWACQQLNAY
YSQCLQGAAPAPARTTAAPPPPPATTAAPPPPTTSAPTGSSPVAGACGAI
ASTVPNYNNAKLPDPFTFANGTALRTKADWSCRRAEISALIQNYEAGTLP
PKPPVVTASFSKSGNTGTLAITAGLSNSQTIKFSPTISYPSGTPPANGWP
LIIAYEGGSIPIPAGVATLTYSNSDMAQQNSASSRGQGLFYQLYGSTHSA
SAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCSRDGKGALMAGAFEE
RIALTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNN
YVQKLPTVPEDHHLLAAMVAPRAMISFENTDYLWLSPMSSFGCMTAAHTV
WQGLGIADSHGFAQVGGHAHCAWPSSLTPQLNAFINRFLLDQSATTNVFT
TNNQFGKVQWNAANWITWTTPTLT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFKPSFVALALVSYATAQASAPQWGQCGGIGWTGPTACPSGWACQQLNAY
YSQCLQGAAPAPARTTAAPPPPPATTAAPPPPTTSAPTGSSPVAGACGAI
ASTVPNYNNAKLPDPFTFANGTALRTKADWSCRRAEISALIQNYEAGTLP
PKPPVVTASFSKSGNTGTLAITAGLSNSQTIKFSPTISYPSGTPPANGWP
LIIAYEGGSIPIPAGVATLTYSNSDMAQQNSASSRGQGLFYQLYGSTHSA
SAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCSRDGKGALMAGAFEE
RIALTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNN
YVQKLPTVPEDHHLLAAMVAPRAMISFENTDYLWLSPMSSFGCMTAAHTV
WQGLGIADSHGFAQVGGHAHCAWPSSLTPQLNAFINRFLLDQSATTNVFT
TNNQFGKVQWNAANWITWTTPTLT


References
    Title: The structural basis of fungal glucuronoyl esterase activity on natural substrates
    Ernst HA, Mosbech C, Langkilde AE, Westh P, Meyer AS, Agger JW, Larsen S
    Ref: Nat Commun, 11:1026, 2020 : PubMed

            

    Title: The natural catalytic function of CuGE glucuronoyl esterase in hydrolysis of genuine lignin-carbohydrate complexes from birch
    Mosbech C, Holck J, Meyer AS, Agger JW
    Ref: Biotechnol Biofuels, 11:71, 2018 : PubMed

            

    Title: Enzymatic degradation of lignin-carbohydrate complexes (LCCs): model studies using a fungal glucuronoyl esterase from Cerrena unicolor
    d'Errico C, Jorgensen JO, Krogh KB, Spodsberg N, Madsen R, Monrad RN
    Ref: Biotechnol Bioeng, 112:914, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer