Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: catad-c7qfj4

Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBR 102108 / JCM 14897) Putative esterase

Relationship
Family|A85-Est-Putative
Block| X
Position in NCBI Life Tree|Catenulispora acidiphila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Catenulisporales: N E > Catenulisporaceae: N E > Catenulispora: N E > Catenulispora acidiphila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001700
1 UniProt : C7QFJ4
1 UniProt : C7QFJ4
1 Interpro : C7QFJ4
1 Pfam : C7QFJ4
1 PIRSF : C7QFJ4
1 SUPERFAM : C7QFJ4
Sequence
Graphical view for this peptide sequence: catad-c7qfj4
Colored MSA for A85-Est-Putative (raw)
MSPTGWPMTVTAILLAVAAPIGTYLLWNRIRGPRPVRAVARLSMIGVSQV
MAILLCGVVVNNYYGLYASWDDLLGQTGSPGVIIHQNAVAAGTPIAGTAV
NGGRAQGGRGQVVPRVRPAGPVQTFKKYGDDALAASFTGPKSRLGGDNNV
LVWLPPQYNDPAYANTDFPVVMLFPGYPGTPQTWFGQMDGQKELAALVQQ
HTSTPFVLVAVNISPIKGVNTDCTDIPGGPQVATYITDDVRTMVERTFRV
TTDRSGWGMMGYSEGGLCAGKLLVQYPQLFSAAVQMSGDVRPGGYVSKYG
PTFADQNSTLWVLQNHKPNPPVSLLAAASAEDAHGSVLSDALSLQHVAPD
VVDVLKKDHGSHNTAVWKQWLPQAYGWLSQHLDQVHPQA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPTGWPMTVTAILLAVAAPIGTYLLWNRIRGPRPVRAVARLSMIGVSQV
MAILLCGVVVNNYYGLYASWDDLLGQTGSPGVIIHQNAVAAGTPIAGTAV
NGGRAQGGRGQVVPRVRPAGPVQTFKKYGDDALAASFTGPKSRLGGDNNV
LVWLPPQYNDPAYANTDFPVVMLFPGYPGTPQTWFGQMDGQKELAALVQQ
HTSTPFVLVAVNISPIKGVNTDCTDIPGGPQVATYITDDVRTMVERTFRV
TTDRSGWGMMGYSEGGLCAGKLLVQYPQLFSAAVQMSGDVRPGGYVSKYG
PTFADQNSTLWVLQNHKPNPPVSLLAAASAEDAHGSVLSDALSLQHVAPD
VVDVLKKDHGSHNTAVWKQWLPQAYGWLSQHLDQVHPQA


Reference
    Title: Complete genome sequence of Catenulispora acidiphila type strain (ID 139908)
    Copeland A, Lapidus A, Glavina Del Rio T, Nolan M, Lucas S, Chen F, Tice H, Cheng JF, Bruce D and Klenk HP <25 more author(s)>
    Ref: Stand Genomic Sci, 1:119, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer