Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canru-2lipa

Candida rugosa (Diutina rugosa) (Yeast) lipase 2 precursor

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Candida rugosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetales incertae sedis: N E > Diutina: N E > Diutina rugosa: N E


Molecular evidence
Database
No mutation
1 structure:
1GZ7: Crystal structure of the closed state of lipase 2 from Candida rugosa
No kinetic





No Substrate
No inhibitor
1 Genbank : X64704
1 UniProt : P32946
1 Ncbi-nid : 2546
1 Structure : 1GZ7
1 UniProt : P32946
1 Interpro : P32946
1 Pfam : P32946
1 PIRSF : P32946
1 SUPERFAM : P32946
Sequence
Graphical view for this peptide sequence: canru-2lipa
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLCLLALGAAVAAAPTATLANGDTITGLNAIVNEKFLGIPFAEPPVGTL
RFKPPVPYSASLNGQQFTSYGPSCMQMNPMGSFEDTLPKNARHLVLQSKI
FQVVLPNDEDCLTINVIRPPGTRASAGLPVMLWIFGGGFELGGSSLFPGD
QMVAKSVLMGKPVIHVSMNYRVASWGFLAGPDIQNEGSGNAGLHDQRLAM
QWVADNIAGFGGDPSKVTIYGESAGSMSTFVHLVWNDGDNTYNGKPLFRA
AIMQSGCMVPSDPVDGTYGTEIYNQVVASAGCGSASDKLACLRGLSQDTL
YQATSDTPGVLAYPSLRLSYLPRPDGTFITDDMYALVRDGKYAHVPVIIG
DQNDEGTLFGLSSLNVTTDAQARAYFKQSFIHASDAEIDTLMAAYTSDIT
QGSPFDTGIFNAITPQFKRISALLGDLAFTLARRYFLNYYQGGTKYSFLS
KQLSGLPVLGTFHGNDIIWQDYLVGSGSVIYNNAFIAFANDLDPNKAGLW
TNWPTYTSSSQSGNNLMQINGLGLYTGKDNFRPDAYSALFSNPPSFFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLCLLALGAAVAAAPTATLANGDTITGLNAIVNEKFLGIPFAEPPVGTL
RFKPPVPYSASLNGQQFTSYGPSCMQMNPMGSFEDTLPKNARHLVLQSKI
FQVVLPNDEDCLTINVIRPPGTRASAGLPVMLWIFGGGFELGGSSLFPGD
QMVAKSVLMGKPVIHVSMNYRVASWGFLAGPDIQNEGSGNAGLHDQRLAM
QWVADNIAGFGGDPSKVTIYGESAGSMSTFVHLVWNDGDNTYNGKPLFRA
AIMQSGCMVPSDPVDGTYGTEIYNQVVASAGCGSASDKLACLRGLSQDTL
YQATSDTPGVLAYPSLRLSYLPRPDGTFITDDMYALVRDGKYAHVPVIIG
DQNDEGTLFGLSSLNVTTDAQARAYFKQSFIHASDAEIDTLMAAYTSDIT
QGSPFDTGIFNAITPQFKRISALLGDLAFTLARRYFLNYYQGGTKYSFLS
KQLSGLPVLGTFHGNDIIWQDYLVGSGSVIYNNAFIAFANDLDPNKAGLW
TNWPTYTSSSQSGNNLMQINGLGLYTGKDNFRPDAYSALFSNPPSFFV


References
    Title: Structural insights into the lipase/esterase behavior in the Candida rugosa lipases family: crystal structure of the lipase 2 isoenzyme at 1.97A resolution
    Mancheno JM, Pernas MA, Martinez MJ, Ochoa B, Rua ML, Hermoso JA
    Ref: Journal of Molecular Biology, 332:1059, 2003 : PubMed

            

    Title: Crystallization and preliminary X-ray diffraction studies of two different crystal forms of the lipase 2 isoform from the yeast Candida rugosa
    Mancheno JJ, Pernas MM, Rua MM, Hermoso JA
    Ref: Acta Crystallographica D Biol Crystallogr, 59:499, 2003 : PubMed

            

    Title: Cloning and nucleotide sequences of two lipase genes from Candida cylindracea
    Longhi S, Fusetti F, Grandori R, Lotti Marina, Vanoni M, Alberghina L, Lotti M
    Ref: Biochimica & Biophysica Acta, 1131:227, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer