Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canal-ppme1

Candida albicans (and strain WO-1)Candida dubliniensis (strain CD36 / CBS 7987 / NCPF 3949 / NRR Y-17841) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1)

Relationship
Family|PPase_methylesterase_euk
Block| X
Position in NCBI Life Tree|Candida albicans SC5314
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida albicans: N E > Candida albicans SC5314: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AACQ01000008, AACQ01000007, FM992689
3 UniProt : Q5ALW7, B9WAJ8, C4YJB1
3 UniProt : Q5ALW7, B9WAJ8, C4YJB1
3 Interpro : Q5ALW7, B9WAJ8, C4YJB1
3 Pfam : Q5ALW7, B9WAJ8, C4YJB1
3 PIRSF : Q5ALW7, B9WAJ8, C4YJB1
3 SUPERFAM : Q5ALW7, B9WAJ8, C4YJB1
Sequence
Graphical view for this peptide sequence: canal-ppme1
Colored MSA for PPase_methylesterase_euk (raw)
MSELHKAFLRRIKEQETALGLSGLVDEDDIPEPAVMPPTGNSSSTANTED
ETILRDYKQFKETNFIQEFYENELGHKFKTYYKPSKKPGSILFCHHGAGS
SSMTFGNLVNHIEDESVGIFLFDTRGHGESVATSDFSLDTLVQDVSFVLE
QFSSKHQQTSIFLLGHSLGGAVLAKYSTLYPSDILKGLILLDIVEEAAVQ
SLNAMPSFIARRPLSFPSLSKAISWHMNFLLFNEKSARLSVPDLFTDKLT
WITDLNATQPYWQTWFSGLSENFLGFKGPKLLMLSTHESLDKQLMIGQMQ
GKYQLVVFKNNEKSGHFVHEDLPNHVAVCLTDYIKRAVAPEIFMKEDLGV
VPKWGGKINK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSELHKAFLRRIKEQETALGLSGLVDEDDIPEPAVMPPTGNSSSTANTED
ETILRDYKQFKETNFIQEFYENELGHKFKTYYKPSKKPGSILFCHHGAGS
SSMTFGNLVNHIEDESVGIFLFDTRGHGESVATSDFSLDTLVQDVSFVLE
QFSSKHQQTSIFLLGHSLGGAVLAKYSTLYPSDILKGLILLDIVEEAAVQ
SLNAMPSFIARRPLSFPSLSKAISWHMNFLLFNEKSARLSVPDLFTDKLT
WITDLNATQPYWQTWFSGLSENFLGFKGPKLLMLSTHESLDKQLMIGQMQ
GKYQLVVFKNNEKSGHFVHEDLPNHVAVCLTDYIKRAVAPEIFMKEDLGV
VPKWGGKINK


References
1 more
    Title: Comparative genomics of the fungal pathogens Candida dubliniensis and Candida albicans
    Jackson AP, Gamble JA, Yeomans T, Moran GP, Saunders D, Harris D, Aslett M, Barrell JF, Butler G and Berriman M <16 more author(s)>
    Ref: Genome Res, 19:2231, 2009 : PubMed

            

    Title: [Cloning and functional study of CaPPe1 in Candida albicans by using Saccharomyses cerevisiae model system]
    Cao F, Chen JY
    Ref: Shi Yan Sheng Wu Xue Bao, 38:119, 2005 : PubMed

            

    Title: The diploid genome sequence of Candida albicans
    Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N and Scherer S <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:7329, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer