Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: byssp-vdta1

Byssochlamys spectabilis (Paecilomyces variotii). Viriditoxin biosynthesis cluster protein A

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Byssochlamys spectabilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Thermoascaceae: N E > Byssochlamys: N E > Byssochlamys spectabilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : RCNU01000014
1 UniProt : A0A443HK81
1 UniProt : A0A443HK81
1 Interpro : A0A443HK81
1 Pfam : A0A443HK81
1 PIRSF : A0A443HK81
1 SUPERFAM : A0A443HK81
Sequence
Graphical view for this peptide sequence: byssp-vdta1
Colored MSA for Thioesterase (raw)
GIDSLLSLVVTSRLNDELELDVSSEDFNDCLTIRDLKAHFMSKNSDNGSS
AVLTPQPSRDSALPERTRPRVADTSDEEDAPVSANEFTTSARSTSKYMAV
LNIISEESGMAIEDFTDNVMFADIGIDSLLSLVIGGRIREELSFDLEVDS
LFVDYPDVKGLRSFFGFESNKTATNPTASQSSSSISSGTSVFDTSPSPTD
LDILTPESSLSQEEFEQPLTIATKPLPPATSVTLQGLPSKAHKILFLFPD
GSGSATSYAKLPRLGADVAIIGLNSPYLMDGANMTCTFDELVTLYLTEIQ
RRQPAGPYHLGGWSAGGILAYRAAQILQKAAANPQKPVVESLLLLDSPPP
TGLGKLPKHFFDYCDQIGIFGQGTAKAPEWLITHFQGTNSVLHEYHATPF
SFGTAPRTGIIWASQTVFETRAVAPPPVRPDDTEDMKFLTERRTDFSAGS
WGHMFPGTEVLIETAYGADHFSLLVSLLFRD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GIDSLLSLVVTSRLNDELELDVSSEDFNDCLTIRDLKAHFMSKNSDNGSS
AVLTPQPSRDSALPERTRPRVADTSDEEDAPVSANEFTTSARSTSKYMAV
LNIISEESGMAIEDFTDNVMFADIGIDSLLSLVIGGRIREELSFDLEVDS
LFVDYPDVKGLRSFFGFESNKTATNPTASQSSSSISSGTSVFDTSPSPTD
LDILTPESSLSQEEFEQPLTIATKPLPPATSVTLQGLPSKAHKILFLFPD
GSGSATSYAKLPRLGADVAIIGLNSPYLMDGANMTCTFDELVTLYLTEIQ
RRQPAGPYHLGGWSAGGILAYRAAQILQKAAANPQKPVVESLLLLDSPPP
TGLGKLPKHFFDYCDQIGIFGQGTAKAPEWLITHFQGTNSVLHEYHATPF
SFGTAPRTGIIWASQTVFETRAVAPPPVRPDDTEDMKFLTERRTDFSAGS
WGHMFPGTEVLIETAYGADHFSLLVSLLFRD


References
    Title: Fungal Dirigent Protein Controls the Stereoselectivity of Multicopper Oxidase-Catalyzed Phenol Coupling in Viriditoxin Biosynthesis
    Hu J, Li H, Chooi YH
    Ref: Journal of the American Chemical Society, 141:8068, 2019 : PubMed

            

    Title: The fungal gene cluster for biosynthesis of the antibacterial agent viriditoxin
    Urquhart AS, Hu J, Chooi YH, Idnurm A
    Ref: Fungal Biol Biotechnol, 6:2, 2019 : PubMed

            

    Title: Genomic and Genetic Insights Into a Cosmopolitan Fungus, Paecilomyces variotii (Eurotiales)
    Urquhart AS, Mondo SJ, Makela MR, Hane JK, Wiebenga A, He G, Mihaltcheva S, Pangilinan J, Lipzen A and Idnurm A <3 more author(s)>
    Ref: Front Microbiol, 9:3058, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer