Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brebn-c0z6i4

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) Putative dipeptidyl-peptidase

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Brevibacillus brevis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Paenibacillaceae: N E > Brevibacillus: N E > Brevibacillus brevis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP008955
1 UniProt : C0Z6I4
1 UniProt : C0Z6I4
1 Interpro : C0Z6I4
1 Pfam : C0Z6I4
1 PIRSF : C0Z6I4
1 SUPERFAM : C0Z6I4
Sequence
Graphical view for this peptide sequence: brebn-c0z6i4
Colored MSA for DPP4N_Peptidase_S9 (raw)
MENVVTWEQYERAQRLHPANYYDAIFNAFVRPNWISGNQFWYIRELRLEK
GTGRQYVIVDAEQNTSQPAFDHERLAVCLSCHAGKTYSAETLPLGELMFT
ESGSAFQFEMDGTVWKCDLQEYSCKPIDHFKKPTMDELPSPDGKWVAFIY
DHNLYVRSLETGRRIRLTYDGKAYYDYGTQPECRLSTVAERLNGSKLPPV
VIWSPDSKMLLTHRLDQRKVREMHLIQSVPKGEGVRPVLHSYRYPIVGDE
HVPLAELVICNLETRTIVRIESEPLQACPVSPLTPGMQMAGWSSDSKQIY
ITRMSRDARSVDFSVADACTGEVCTLLREQSDTFLNQDLHNLGASNPNIR
LLADGSFIWHSERDGWSHLYHCDGKTGAIRNPITSGPWTVRRLMAVDEQQ
GWVYITGGGLEEGRDPYYQHLYRVRLDGTGLSLLTPEDAEHDIVFSPTMK
YFVDTFSRVDLPPVTVLRSVDGSLIRELEYADVEMLLEMGYQFPERITVK
ARDGVTDLYGVMLRPFPFDSSRKYPVVDYIYGGPQIINTPKAFALDPGRN
HDPLGGGQSLAQLGFIVLILDGMGTPYRSKAFHDVSDRKLEEAGGLLDHM
TAVRQLAERYPYVDIDRVGIWGSSGGGYASTRAILSFPDCYKVAVSACGN
HDQRLYIAAWAERYQGLYDPVLYRDQDNARLAANLKGKLLLVSGDMDDNV
HPSQTIRMADALVKADKDFDMLILPNRHHGFSMEPYFIRRKWDYFIRHLM
RAEPPWGNQIANKKASDREPIEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MENVVTWEQYERAQRLHPANYYDAIFNAFVRPNWISGNQFWYIRELRLEK
GTGRQYVIVDAEQNTSQPAFDHERLAVCLSCHAGKTYSAETLPLGELMFT
ESGSAFQFEMDGTVWKCDLQEYSCKPIDHFKKPTMDELPSPDGKWVAFIY
DHNLYVRSLETGRRIRLTYDGKAYYDYGTQPECRLSTVAERLNGSKLPPV
VIWSPDSKMLLTHRLDQRKVREMHLIQSVPKGEGVRPVLHSYRYPIVGDE
HVPLAELVICNLETRTIVRIESEPLQACPVSPLTPGMQMAGWSSDSKQIY
ITRMSRDARSVDFSVADACTGEVCTLLREQSDTFLNQDLHNLGASNPNIR
LLADGSFIWHSERDGWSHLYHCDGKTGAIRNPITSGPWTVRRLMAVDEQQ
GWVYITGGGLEEGRDPYYQHLYRVRLDGTGLSLLTPEDAEHDIVFSPTMK
YFVDTFSRVDLPPVTVLRSVDGSLIRELEYADVEMLLEMGYQFPERITVK
ARDGVTDLYGVMLRPFPFDSSRKYPVVDYIYGGPQIINTPKAFALDPGRN
HDPLGGGQSLAQLGFIVLILDGMGTPYRSKAFHDVSDRKLEEAGGLLDHM
TAVRQLAERYPYVDIDRVGIWGSSGGGYASTRAILSFPDCYKVAVSACGN
HDQRLYIAAWAERYQGLYDPVLYRDQDNARLAANLKGKLLLVSGDMDDNV
HPSQTIRMADALVKADKDFDMLILPNRHHGFSMEPYFIRRKWDYFIRHLM
RAEPPWGNQIANKKASDREPIEK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer