Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brajp-g7daf5

Bradyrhizobium japonicum Putative uncharacterized protein Type III effector NopAV

Comment
Other strains: Bradyrhizobium japonicum (USDA 6; SEMIA 5079)


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Bradyrhizobium japonicum USDA 6
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium japonicum: N E > Bradyrhizobium japonicum USDA 6: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brajp-g7daf5
Colored MSA for Carb_B_Bacteria (raw)
MLTNAVSTTSGPIIGAEQNGLRAFKGVPFATARRFAKATPPLAWTEPRQC
SDYGAYAPQPGHLDHADEESCLSLNIWAPAADHPLPVKFFIHGGAFVTGG
GADYDGSFLAVHGPAVIVTINYRLGPLGFLQLHRHGFTEANNLALQDTLA
ALDWVHANIANFGGDPDAITLSGQSAGASMVIALATLPQARGKFIRALAL
SAPGRDIMSAGHADDVARHVLEELELARDPGAIASVPLPKLFAAVERVGR
RFADETDAGTLFGPVLDGTVIAREPRDVFTDGTLRDIPLWLGSCRDEMVM
FLKSNPPAAMIRTTERQVRAAFGDAGWCRLLSYYRATARLDEDPYEALLS
DAFWHRPMADLARRHAAAGGAVWLSRFDHRPALEPFLSQGPTHGADNACL
WAHLPDFIYRPILKRKGGPMTPADIDVAARLQASLLCFVTTGVPDVEQAW
PRFAPGNEPLAIFGQPFHIVPLNDGARFRVWAELTEQSRPEVVA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLTNAVSTTSGPIIGAEQNGLRAFKGVPFATARRFAKATPPLAWTEPRQC
SDYGAYAPQPGHLDHADEESCLSLNIWAPAADHPLPVKFFIHGGAFVTGG
GADYDGSFLAVHGPAVIVTINYRLGPLGFLQLHRHGFTEANNLALQDTLA
ALDWVHANIANFGGDPDAITLSGQSAGASMVIALATLPQARGKFIRALAL
SAPGRDIMSAGHADDVARHVLEELELARDPGAIASVPLPKLFAAVERVGR
RFADETDAGTLFGPVLDGTVIAREPRDVFTDGTLRDIPLWLGSCRDEMVM
FLKSNPPAAMIRTTERQVRAAFGDAGWCRLLSYYRATARLDEDPYEALLS
DAFWHRPMADLARRHAAAGGAVWLSRFDHRPALEPFLSQGPTHGADNACL
WAHLPDFIYRPILKRKGGPMTPADIDVAARLQASLLCFVTTGVPDVEQAW
PRFAPGNEPLAIFGQPFHIVPLNDGARFRVWAELTEQSRPEVVA


References
    Title: Comparative genomics of Bradyrhizobium japonicum CPAC 15 and Bradyrhizobium diazoefficiens CPAC 7: elite model strains for understanding symbiotic performance with soybean
    Siqueira AF, Ormeno-Orrillo E, Souza RC, Rodrigues EP, Almeida LG, Barcellos FG, Batista JS, Nakatani AS, Martinez-Romero E and Hungria M <1 more author(s)>
    Ref: BMC Genomics, 15:420, 2014 : PubMed

            

    Title: Mutualistic co-evolution of type III effector genes in Sinorhizobium fredii and Bradyrhizobium japonicum
    Kimbrel JA, Thomas WJ, Jiang Y, Creason AL, Thireault CA, Sachs JL, Chang JH
    Ref: PLoS Pathog, 9:e1003204, 2013 : PubMed

            

    Title: Complete Genome Sequence of the Soybean Symbiont Bradyrhizobium japonicum Strain USDA6T
    Kaneko T, Maita H, Hirakawa H, Uchiike N, Minamisawa K, Watanabe A, Sato S
    Ref: Genes (Basel), 2:763, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer