Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bpml5-vg12

Mycobacterium phage L5 (Mycobacteriophage L5) Gp12

Relationship
Family|Lysin_B_C_ter
Block| X
Position in NCBI Life Tree|Mycobacterium phage L5
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> Viruses: N E > dsDNA viruses, no RNA stage: N E > Caudovirales: N E > Siphoviridae: N E > L5virus: N E > Mycobacterium virus L5: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : Z18946
1 UniProt : Q05328
1 UniProt : Q05328
1 Interpro : Q05328
1 Pfam : Q05328
1 PIRSF : Q05328
1 SUPERFAM : Q05328
Sequence
Graphical view for this peptide sequence: bpml5-vg12
Colored MSA for Lysin_B_C_ter (raw)
MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMW
PSVEKGVAELILQIELKLDADPYADFALAGYSQGAIVVGQVLKHHIINPR
GRLHRFLHRLRKVIFWGNPMRQKGFAHTDEWIHQVAASDTMGILEDRLEN
LEQYGFEVRDYAHDGDMYASIKEDDMHEYEVAIGRIVMSARRFIGGKDSV
IAQLIELGQRPIWEGIAMARAIIDALTFFAKSTQGPSWPHLYNRFPAVEF
LRRI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMW
PSVEKGVAELILQIELKLDADPYADFALAGYSQGAIVVGQVLKHHIINPR
GRLHRFLHRLRKVIFWGNPMRQKGFAHTDEWIHQVAASDTMGILEDRLEN
LEQYGFEVRDYAHDGDMYASIKEDDMHEYEVAIGRIVMSARRFIGGKDSV
IAQLIELGQRPIWEGIAMARAIIDALTFFAKSTQGPSWPHLYNRFPAVEF
LRRI


Reference
    Title: DNA sequence, structure and gene expression of mycobacteriophage L5: a phage system for mycobacterial genetics
    Hatfull GF, Sarkis GJ
    Ref: Molecular Microbiology, 7:395, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer