Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: botci-cutas

Botrytis cinerea cutA gene, CutA, cutinase A

Comment
Other strains: Botryotinia fuckeliana (strain T4) (Noble rot fungus) (Botrytis cinerea)


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Botrytis cinerea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Leotiomycetes: N E > Helotiales: N E > Sclerotiniaceae: N E > Botrytis: N E > Botrytis cinerea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : Z69264, FQ790286
2 UniProt : Q00298, G2Y3J6
1 Ncbi-nid : 1177241
1 Ncbi-pid : 1177242
2 UniProt : Q00298, G2Y3J6
2 Interpro : Q00298, G2Y3J6
2 Pfam : Q00298, G2Y3J6
2 PIRSF : Q00298, G2Y3J6
2 SUPERFAM : Q00298, G2Y3J6
Sequence
Graphical view for this peptide sequence: botci-cutas
Colored MSA for Cutinase (raw)
MKTSAQQLLSALLLPLSVLAAPTGSIEARACSDVTVIFARGTTETGTLGT
VVGPPFLAALKSALGSSSVTMNGVDYPADVPGFLQGGDPAGSQTMATMVT
STLSSCPDTKLVISGYSQGGQLVHNAAKLLPAETTAKISSAVIFGDPDNG
DPVQGVSADRTDIICHAGDNICQGGSLILLAHLTYGMDTTAAAAFVKKAA
GL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTSAQQLLSALLLPLSVLAAPTGSIEARACSDVTVIFARGTTETGTLGT
VVGPPFLAALKSALGSSSVTMNGVDYPADVPGFLQGGDPAGSQTMATMVT
STLSSCPDTKLVISGYSQGGQLVHNAAKLLPAETTAKISSAVIFGDPDNG
DPVQGVSADRTDIICHAGDNICQGGSLILLAHLTYGMDTTAAAAFVKKAA
GL


References
    Title: Genomic analysis of the necrotrophic fungal pathogens Sclerotinia sclerotiorum and Botrytis cinerea
    Amselem J, Cuomo CA, van Kan JA, Viaud M, Benito EP, Couloux A, Coutinho PM, de Vries RP, Dyer PS and Dickman M <62 more author(s)>
    Ref: PLoS Genet, 7:e1002230, 2011 : PubMed

            

    Title: Cloning and expression of the cutinase A gene of Botrytis cinerea
    van der Vlugt-Bergmans CJ, Wagemakers CA, van Kan JA
    Ref: Mol Plant Microbe Interact, 10:21, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer