Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: boiir-a0a0b8rs13

Boiga irregularis (Brown tree snake). Carboxylic ester hydrolase

Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Boiga irregularis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Lepidosauria: N E > Squamata: N E > Bifurcata: N E > Unidentata: N E > Episquamata: N E > Toxicofera: N E > Serpentes: N E > Colubroidea: N E > Colubridae: N E > Colubrinae: N E > Boiga: N E > Boiga irregularis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GBSH01000060
1 UniProt : A0A0B8RS13
1 UniProt : A0A0B8RS13
1 Interpro : A0A0B8RS13
1 Pfam : A0A0B8RS13
1 PIRSF : A0A0B8RS13
1 SUPERFAM : A0A0B8RS13
Sequence
Graphical view for this peptide sequence: boiir-a0a0b8rs13
Colored MSA for Cholinesterase-like (raw)
MLHFLWSRLSFFFFLSLVCKCASNNDTPIVTSSGPIKGKIVMTRSGSVTA
YLGIPYAEPPVNKLRFQKPVPRQPWSEVLEATSFGNSCPQANIPGLPDKE
IWVPNTPLSEDCLFLNIWAPHPQPSRPVPVLVWMPGMGFITGTSSLDIYN
GEILSATEKVIVVSINYRLGGLGFLYLPPYAPGNVGLWDQHLALMWLKEN
IALFGGDPAQLTLVGQSAGAVLVSCHLLSPLSQPLFARAVLQSGVPNAIW
PWKSPQEARTDAIMLSKQVGCAKDNDRAVVSCLQEIDFAHENFTHLTLIN
SLTTDGHFLPGKVPNLLDTAILQGKPILTGVTDDEGSAFVLLMYPSTKTN
GGLLTWEQLLQGVTITLRRGTTKEVARTVAQKFSEANHEQYRLAFSQYMR
DYFMVCPLIELAAKIRKAGKSVHVYSFSHHPSGSGWPEWVGTPHGAEIPY
VFGTMASATNRSITEAEEALSRQTMRYWAQFARGGSPTVPKPDEIQWPLY
DATEQNFFHISTGAPQIKRLSPAPLCDFLATLPVNDIPSSKKSPEDPDS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHFLWSRLSFFFFLSLVCKCASNNDTPIVTSSGPIKGKIVMTRSGSVTA
YLGIPYAEPPVNKLRFQKPVPRQPWSEVLEATSFGNSCPQANIPGLPDKE
IWVPNTPLSEDCLFLNIWAPHPQPSRPVPVLVWMPGMGFITGTSSLDIYN
GEILSATEKVIVVSINYRLGGLGFLYLPPYAPGNVGLWDQHLALMWLKEN
IALFGGDPAQLTLVGQSAGAVLVSCHLLSPLSQPLFARAVLQSGVPNAIW
PWKSPQEARTDAIMLSKQVGCAKDNDRAVVSCLQEIDFAHENFTHLTLIN
SLTTDGHFLPGKVPNLLDTAILQGKPILTGVTDDEGSAFVLLMYPSTKTN
GGLLTWEQLLQGVTITLRRGTTKEVARTVAQKFSEANHEQYRLAFSQYMR
DYFMVCPLIELAAKIRKAGKSVHVYSFSHHPSGSGWPEWVGTPHGAEIPY
VFGTMASATNRSITEAEEALSRQTMRYWAQFARGGSPTVPKPDEIQWPLY
DATEQNFFHISTGAPQIKRLSPAPLCDFLATLPVNDIPSSKKSPEDPDS


Reference
    Title: RNA-seq and high-definition mass spectrometry reveal the complex and divergent venoms of two rear-fanged colubrid snakes
    McGivern JJ, Wray KP, Margres MJ, Couch ME, Mackessy SP, Rokyta DR
    Ref: BMC Genomics, 15:1061, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer