Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bifli-c2gxu7

Bifidobacterium longum (and subsp. infantis ATCC 55813; CCUG 52486; DJO10A; ATCC15697/DSM2008/JCM1222/NCTC11817/S12) Esterase

Comment
BL0571 incomplete in N-term


Relationship
Family|A85-Est-Putative
Block| X
Position in NCBI Life Tree|Bifidobacterium longum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium longum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: ACHI01000126, AE014678, DS990238
>3 UniProt links 1 more: C2GXU7, C5E9M8, B3DNV1
>3 UniProt links 2 more: C2GXU7, Q8G6R7, C5E9M8
>3 Interpro links 2 more: C2GXU7, Q8G6R7, C5E9M8
>3 Pfam links 2 more: C2GXU7, Q8G6R7, C5E9M8
>3 PIRSF links 2 more: C2GXU7, Q8G6R7, C5E9M8
>3 SUPERFAM links 2 more: C2GXU7, Q8G6R7, C5E9M8
Sequence
Graphical view for this peptide sequence: bifli-c2gxu7
Colored MSA for A85-Est-Putative (raw)
MKNSVWKTFMELSLVRGIVPRTVFGLTAIAAIILVIGLALSKSNKRGRLH
PLIVSLIAAVLAGAAGMLVAWLVSDVFMVFGVSLGWPVIFTIAGGIAGVG
FVIAAAVTMRGARRVLAIVLVPLVLLSTALGVDSIYGEYQTIGTLVGYTP
YASLGSIEVHKAAMSVSDWRSKAQKGSLPSMPSQGKVLTVDIPNAKSNFT
ARKAMIYLPPAALSDRPPALPVMELLAGQPGSPSRLIDAGNIAATMNAYA
AKHDGLAPIVLVPDQNGEATHNSLCADTTQGNAETYLTTDVVNWAKKMLP
VAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELKPTNGSVAK
MVQEYFAGDRKAYDEQVPVNAIAATGTPEQALFTGAGERDKESISNMRTI
ADAARKAGMEVTELIVPGTGHDWHAVQAVWRPGLDWFGERTGLGEMTKSL
KEYPQVEVLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNSVWKTFMELSLVRGIVPRTVFGLTAIAAIILVIGLALSKSNKRGRLH
PLIVSLIAAVLAGAAGMLVAWLVSDVFMVFGVSLGWPVIFTIAGGIAGVG
FVIAAAVTMRGARRVLAIVLVPLVLLSTALGVDSIYGEYQTIGTLVGYTP
YASLGSIEVHKAAMSVSDWRSKAQKGSLPSMPSQGKVLTVDIPNAKSNFT
ARKAMIYLPPAALSDRPPALPVMELLAGQPGSPSRLIDAGNIAATMNAYA
AKHDGLAPIVLVPDQNGEATHNSLCADTTQGNAETYLTTDVVNWAKKMLP
VAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELKPTNGSVAK
MVQEYFAGDRKAYDEQVPVNAIAATGTPEQALFTGAGERDKESISNMRTI
ADAARKAGMEVTELIVPGTGHDWHAVQAVWRPGLDWFGERTGLGEMTKSL
KEYPQVEVLQ


References
1 more
    Title: Comparative genomic analysis of the gut bacterium Bifidobacterium longum reveals loci susceptible to deletion during pure culture growth
    Lee JH, Karamychev VN, Kozyavkin SA, Mills D, Pavlov AR, Pavlova NV, Polouchine NN, Richardson PM, Shakhova VV and O'Sullivan DJ <2 more author(s)>
    Ref: BMC Genomics, 9:247, 2008 : PubMed

            

    Title: The genome sequence of Bifidobacterium longum subsp. infantis reveals adaptations for milk utilization within the infant microbiome
    Sela DA, Chapman J, Adeuya A, Kim JH, Chen F, Whitehead TR, Lapidus A, Rokhsar DS, Lebrilla CB and Mills DA <3 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 105:18964, 2008 : PubMed

            

    Title: The genome sequence of Bifidobacterium longum reflects its adaptation to the human gastrointestinal tract
    Schell MA, Karmirantzou M, Snel B, Vilanova D, Berger B, Pessi G, Zwahlen MC, Desiere F, Bork P and Arigoni F <2 more author(s)>
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 99:14422, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer