Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bifdb-d2q9l6

Bifidobacterium dentium (strains ATCC 27534 / DSM 20436 / JCM 1195 Bd1; ATCC 27678) Putative uncharacterized protein

Relationship
Family|A85-Est-Putative
Block| X
Position in NCBI Life Tree|Bifidobacterium dentium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium dentium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP001750, ABIX02000002
1 UniProt : D2Q9L6
1 UniProt : D2Q9L6
1 Interpro : D2Q9L6
1 Pfam : D2Q9L6
1 PIRSF : D2Q9L6
1 SUPERFAM : D2Q9L6
Sequence
Graphical view for this peptide sequence: bifdb-d2q9l6
Colored MSA for A85-Est-Putative (raw)
MRQWLMNVSLLQGWLPATLFAITAALIVILLIGAIATIRKAGLKPVLMPL
VVAAVAGAVGFVITWLLSDVFMVFGVELGPHVFVWTSAGCATVGFAVTHM
AMRRRASRALAVILVIFALLASALGIDQAYGEYATLGSLFGVDSYHEADL
TGMADRRDLITIAQWRQGVADHTIRNVPSHGAVDKVDIPATTSGFKARKA
LVYLPPAALVPTKAKPALPVILMLSGQPGCPNRVFNAGGIQTMMDDYAQH
HQGLAPIVIAADQLGADSHNTLCVDSQVYGNALTYLTQDVVDWVKDNLPA
AQDAKDWAIAGFSQGATCSMQIGPNYPNLFGTIIPTGSEIGPSNGSEQEM
IDRFFDGDREAYERQIPINAIRNHAPSDQTLIMGTGEKDVESLRNIEEIA
PVARKAGMHVTAVESLGNAHDWHAVQDTLRYGLAVFGYDTGMSSVKPKLS
DYTNLRRIKIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRQWLMNVSLLQGWLPATLFAITAALIVILLIGAIATIRKAGLKPVLMPL
VVAAVAGAVGFVITWLLSDVFMVFGVELGPHVFVWTSAGCATVGFAVTHM
AMRRRASRALAVILVIFALLASALGIDQAYGEYATLGSLFGVDSYHEADL
TGMADRRDLITIAQWRQGVADHTIRNVPSHGAVDKVDIPATTSGFKARKA
LVYLPPAALVPTKAKPALPVILMLSGQPGCPNRVFNAGGIQTMMDDYAQH
HQGLAPIVIAADQLGADSHNTLCVDSQVYGNALTYLTQDVVDWVKDNLPA
AQDAKDWAIAGFSQGATCSMQIGPNYPNLFGTIIPTGSEIGPSNGSEQEM
IDRFFDGDREAYERQIPINAIRNHAPSDQTLIMGTGEKDVESLRNIEEIA
PVARKAGMHVTAVESLGNAHDWHAVQDTLRYGLAVFGYDTGMSSVKPKLS
DYTNLRRIKIS


Reference
    Title: The Bifidobacterium dentium Bd1 genome sequence reflects its genetic adaptation to the human oral cavity
    Ventura M, Turroni F, Zomer A, Foroni E, Giubellini V, Bottacini F, Canchaya C, Claesson MJ, He F and van Sinderen D <13 more author(s)>
    Ref: PLoS Genet, 5:e1000785, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer