Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bifan-b2eam2

Bifidobacterium animalis subsp. lactis Probable dipeptidyl peptidase IV

Comment
Other strains: Bifidobacterium animalis subsp. lactis (strains HN019; AD011; Bl-04 / DGCC2908 / R 4825 / SD5219; DSM 10140 / JCM 10602 / LMG 18314; BB-12; V9)


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Bifidobacterium animalis subsp. lactis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium animalis: N E > Bifidobacterium animalis subsp. lactis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: ABOT01000004, CP001213, CP001515
1 UniProt : B8DV84
1 UniProt : B8DV84
1 Interpro : B8DV84
1 Pfam : B8DV84
1 PIRSF : B8DV84
1 SUPERFAM : B8DV84
Sequence
Graphical view for this peptide sequence: bifan-b2eam2
Colored MSA for DPP4N_Peptidase_S9 (raw)
MESAIEEYPVRKAKTVRFTCGAPRSPKLIGDGSRMLFLRSAGEQDTENSL
WLAICGEDAYAEVELVNAGELVNTLGSDDVPAAERARRERARESATGIVA
YSVDGLGNHVAFTVNGELFVTTIDWDALAYTVGDDGVRAQVGAGVRTEHL
VPQFADSAQNEFAGPVLNPRMSPDGKRVAYATGSAVVVVDVQTAVANAVF
TVSPQDRETMRAGLAEFAAGEEMDRYDGFWWGPDSRTLLVECFDSSPEPV
WTISDPADPAARGIQHRYPRALTENAVVDLFAVRLGDDGTSVQKTAMIDW
DNVAYEYLAVVDWQAERPVLRVLDRLQQHEQILRVAMPAENEWGDLRALD
GNVMALLPVEVIAEHHNDQWIDLVGGTPCVTPSGAVVCSVNDMEADTNRL
SVDGRVFTPAGWQVREVLDAGTDDVLCVVQRTAERAAEVPEQWADSTAER
YHDARSFDIVTISYADGSVRAVSDEPGVWRASRRGDGLVVWGRTMDSAKA
VMRLSYGAEGARTGHDVCNVAAEPDFVPNVRFVRLGERKLFTAIVAPSAS
SRFAGAAELPVLMHPYGGPGHQEVVMSRAAYLDAQWWADQGYLVVIADGR
GTTGRGPVWDREVYLQMKRVSLADQVDAVHALAGAVDELNRMGGAAEGCE
FGGHDDAARPLPKPDLERVAMIGWSYGGFLSALAVLDAPDTFAAACAGAP
PTDWTLYDTCYTERFLGLDPQVYADNSIVLDAPKLVRPLMLIHGFADDNV
TIAHSLRLSQALMEAGRPHTFLPLTGITHMTNDPDVARNLLILQRDFLSD
ALAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MESAIEEYPVRKAKTVRFTCGAPRSPKLIGDGSRMLFLRSAGEQDTENSL
WLAICGEDAYAEVELVNAGELVNTLGSDDVPAAERARRERARESATGIVA
YSVDGLGNHVAFTVNGELFVTTIDWDALAYTVGDDGVRAQVGAGVRTEHL
VPQFADSAQNEFAGPVLNPRMSPDGKRVAYATGSAVVVVDVQTAVANAVF
TVSPQDRETMRAGLAEFAAGEEMDRYDGFWWGPDSRTLLVECFDSSPEPV
WTISDPADPAARGIQHRYPRALTENAVVDLFAVRLGDDGTSVQKTAMIDW
DNVAYEYLAVVDWQAERPVLRVLDRLQQHEQILRVAMPAENEWGDLRALD
GNVMALLPVEVIAEHHNDQWIDLVGGTPCVTPSGAVVCSVNDMEADTNRL
SVDGRVFTPAGWQVREVLDAGTDDVLCVVQRTAERAAEVPEQWADSTAER
YHDARSFDIVTISYADGSVRAVSDEPGVWRASRRGDGLVVWGRTMDSAKA
VMRLSYGAEGARTGHDVCNVAAEPDFVPNVRFVRLGERKLFTAIVAPSAS
SRFAGAAELPVLMHPYGGPGHQEVVMSRAAYLDAQWWADQGYLVVIADGR
GTTGRGPVWDREVYLQMKRVSLADQVDAVHALAGAVDELNRMGGAAEGCE
FGGHDDAARPLPKPDLERVAMIGWSYGGFLSALAVLDAPDTFAAACAGAP
PTDWTLYDTCYTERFLGLDPQVYADNSIVLDAPKLVRPLMLIHGFADDNV
TIAHSLRLSQALMEAGRPHTFLPLTGITHMTNDPDVARNLLILQRDFLSD
ALAR


References
1 more
    Title: Complete genome sequence of Bifidobacterium animalis subsp. lactis BB-12, a widely consumed probiotic strain
    Garrigues C, Johansen E, Pedersen MB
    Ref: Journal of Bacteriology, 192:2467, 2010 : PubMed

            

    Title: Comparison of the complete genome sequences of Bifidobacterium animalis subsp. lactis DSM 10140 and Bl-04
    Barrangou R, Briczinski EP, Traeger LL, Loquasto JR, Richards M, Horvath P, Coute-Monvoisin AC, Leyer G, Rendulic S and Roberts RF <6 more author(s)>
    Ref: Journal of Bacteriology, 191:4144, 2009 : PubMed

            

    Title: Genome sequence of the probiotic bacterium Bifidobacterium animalis subsp. lactis AD011
    Kim JF, Jeong H, Yu DS, Choi SH, Hur CG, Park MS, Yoon SH, Kim DW, Ji GE and Oh TK <1 more author(s)>
    Ref: Journal of Bacteriology, 191:678, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer