Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bifan-b2e8c8

Bifidobacterium animalis subsp. lactis. Proline iminopeptidase

Comment
Other strains: Bifidobacterium animalis subsp. lactis (strains HN019: AD011; Bl-04 / DGCC2908 / RB 4825 / SD5219; DSM 10140 / JCM 10602 / LMG 18314; BB-12; V9; CNCM I-2494; BLC1; BS 01; Bi-07; B420; Bl12; CECT 8145)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Bifidobacterium animalis subsp. lactis HN019
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium animalis: N E > Bifidobacterium animalis subsp. lactis: N E > Bifidobacterium animalis subsp. lactis HN019: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bifan-b2e8c8
Colored MSA for Proline_iminopeptidase (raw)
MALLNEYYVPGLHVSEYAIDVPLDWDGHEPGMGFDGETIRLFYRVVCAPE
HVNDRLPLLVFLQGGPGGAAPRPLSPDSDGWVAEAIKHFRVVLPDQRGTG
RSSHIDSHTVANMDGRQAAEYLKKFLAGPIVRDFEHLRRTEFDGERWVTL
GQSYGGFLTLTYLSLFPQSLIASFTTGGIPHVPASAREVYEHTFPRMQTK
TEQFYARYPLDTKRVGCVADILRSTDVTLPNGDPFTVERLQTLGSSFGMK
PAFERVHWLFDEAFLDGDGSANSDSPLADEFLFDAMTATYSNPLYWPLQE
FIYADGDLDAPIDWAADHVYGSLPQFSTDARPLLFTGEAIFPWMFEQERA
LRPFRAAMDVLMQDTHFGVIYNVNQLAANTVPLNSAVYFDDLYVDSGLQL
DTLSRIGNSHYWVTNEFEHDGVHGGIVFRHLFDEARDRGDLHELF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALLNEYYVPGLHVSEYAIDVPLDWDGHEPGMGFDGETIRLFYRVVCAPE
HVNDRLPLLVFLQGGPGGAAPRPLSPDSDGWVAEAIKHFRVVLPDQRGTG
RSSHIDSHTVANMDGRQAAEYLKKFLAGPIVRDFEHLRRTEFDGERWVTL
GQSYGGFLTLTYLSLFPQSLIASFTTGGIPHVPASAREVYEHTFPRMQTK
TEQFYARYPLDTKRVGCVADILRSTDVTLPNGDPFTVERLQTLGSSFGMK
PAFERVHWLFDEAFLDGDGSANSDSPLADEFLFDAMTATYSNPLYWPLQE
FIYADGDLDAPIDWAADHVYGSLPQFSTDARPLLFTGEAIFPWMFEQERA
LRPFRAAMDVLMQDTHFGVIYNVNQLAANTVPLNSAVYFDDLYVDSGLQL
DTLSRIGNSHYWVTNEFEHDGVHGGIVFRHLFDEARDRGDLHELF


References
5 more
    Title: Comparative genomics of Bifidobacterium animalis subsp. lactis reveals a strict monophyletic bifidobacterial taxon
    Milani C, Duranti S, Lugli GA, Bottacini F, Strati F, Arioli S, Foroni E, Turroni F, van Sinderen D, Ventura M
    Ref: Applied Environmental Microbiology, 79:4304, 2013 : PubMed

            

    Title: Complete genome sequences of probiotic strains Bifidobacterium animalis subsp. lactis B420 and Bi-07
    Stahl B, Barrangou R
    Ref: Journal of Bacteriology, 194:4131, 2012 : PubMed

            

    Title: Complete genome sequence of Bifidobacterium animalis subsp. lactis BLC1
    Bottacini F, Dal Bello F, Turroni F, Milani C, Duranti S, Foroni E, Viappiani A, Strati F, Mora D and Ventura M <1 more author(s)>
    Ref: Journal of Bacteriology, 193:6387, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer