Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bifaa-a1a124

Bifidobacterium adolescentis (strains ATCC15703/DSM20083/NCT11814/E194a; L2-32) Putative uncharacterized protein

Relationship
Family|A85-Est-Putative
Block| X
Position in NCBI Life Tree|Bifidobacterium adolescentis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium adolescentis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AP009256, AAXD02000018
2 UniProt : A1A124, A7A574
2 UniProt : A1A124, A7A574
2 Interpro : A1A124, A7A574
2 Pfam : A1A124, A7A574
2 PIRSF : A1A124, A7A574
2 SUPERFAM : A1A124, A7A574
Sequence
Graphical view for this peptide sequence: bifaa-a1a124
Colored MSA for A85-Est-Putative (raw)
MLGMGKMRQWLMNISLVGGWFPAAAFAVVAVLSVTLLVSAAVSKRDGRIL
ATVLPIGVAAVSGMIGYVVAWLLSDVFVVFGVGLGSRVMAWVAAGFAIAG
FAIAHIVLSRGMMRVAAAILTVFAILAAAIGIDQSYGEYATIGSLFGEDS
YSQADLTGLAKRKDLITVAQWRKQAANGTIRNIPANGTVNKIDIPATKSQ
FEARKALVYLPPAALADSKRKPALPVVLMLSGQPGSPGRVFQAGGIQTMM
DGYAKTHDGLAPIVIAADQLGADSHNTLCVDSKVYGNALTYLTQDVVDWV
KTNLPAAQDAKDWAIAGFSQGATCSLQIGVNHPDLFGTMIPTDSEIKPTN
GSRQEMIDRFFDGDTTAYENQVPVNAIRNHAPTHQMLIIGAGEKDTTSIR
NVKTIAPVAAKAGMRVAAVESSGNAHDWHAVQDVLRYGLAVFGHDTGLDG
ANPNLSDYPNLKRITI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLGMGKMRQWLMNISLVGGWFPAAAFAVVAVLSVTLLVSAAVSKRDGRIL
ATVLPIGVAAVSGMIGYVVAWLLSDVFVVFGVGLGSRVMAWVAAGFAIAG
FAIAHIVLSRGMMRVAAAILTVFAILAAAIGIDQSYGEYATIGSLFGEDS
YSQADLTGLAKRKDLITVAQWRKQAANGTIRNIPANGTVNKIDIPATKSQ
FEARKALVYLPPAALADSKRKPALPVVLMLSGQPGSPGRVFQAGGIQTMM
DGYAKTHDGLAPIVIAADQLGADSHNTLCVDSKVYGNALTYLTQDVVDWV
KTNLPAAQDAKDWAIAGFSQGATCSLQIGVNHPDLFGTMIPTDSEIKPTN
GSRQEMIDRFFDGDTTAYENQVPVNAIRNHAPTHQMLIIGAGEKDTTSIR
NVKTIAPVAAKAGMRVAAVESSGNAHDWHAVQDVLRYGLAVFGHDTGLDG
ANPNLSDYPNLKRITI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer