Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: balas-a0a383zdz5

Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni). Pancreatic lipase

Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Balaenoptera acutorostrata scammoni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Cetacea: N E > Mysticeti: N E > Balaenopteridae: N E > Balaenoptera: N E > Balaenoptera acutorostrata: N E > Balaenoptera acutorostrata scammoni: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : XP_007173410
1 UniProt : A0A383ZDZ5
1 UniProt : A0A383ZDZ5
1 Interpro : A0A383ZDZ5
1 Pfam : A0A383ZDZ5
1 PIRSF : A0A383ZDZ5
1 SUPERFAM : A0A383ZDZ5
Sequence
Graphical view for this peptide sequence: balas-a0a383zdz5
Colored MSA for Pancreatic_lipase (raw)
MEPAKMMLIWSNSGIRKESWFEDSPLKAMALAFLSSTNNHPEAAAGSSFL
ILPEPKAWCPLKKPSPSRLATPPQGPEYQLWSTVCTPPTPLGSSKFPHLY
NSTSSVSSTSPSGEVCYERVGCFKDGIPWTGTLSRKMAGLPXSPEKINTR
FLLYTRHNPKVHQEISAANYLTIQASHFGTDKITHINIPGWKADGXWQQD
MCNVFLKVEDVNCINLDWINGLLQYIHAVNNLRVVGAEVACVIDVLVKIF
GYSPSKVHLIGHSLGAYLAGEAGSRTPGLGRITGLDPTGPDFHNTPNEVR
LDPSDADSVDVIHTNEVRFLFELGVGTINACGHLDFYPNGGKHMPGCEDL
ITPLFKFDLNIYREEMFSFFDCNHARSHCFYAESILNPDAFIAYPCRSYK
SFKAGNCFHCRKEGCPTMGHFADRFHLKKMKSNRSYYFLNTGTLSPFARW
RHKLSVKLDGNNATQGSIFLRVGGTTEKTGEFGVVSGTLKPGMTYTNLID
ADINIGNIASIEFIWKELSFEHSQNKLGAEMVIDISGKYGYESAFCSXNL
VGPNIAQILKPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEPAKMMLIWSNSGIRKESWFEDSPLKAMALAFLSSTNNHPEAAAGSSFL
ILPEPKAWCPLKKPSPSRLATPPQGPEYQLWSTVCTPPTPLGSSKFPHLY
NSTSSVSSTSPSGEVCYERVGCFKDGIPWTGTLSRKMAGLPXSPEKINTR
FLLYTRHNPKVHQEISAANYLTIQASHFGTDKITHINIPGWKADGXWQQD
MCNVFLKVEDVNCINLDWINGLLQYIHAVNNLRVVGAEVACVIDVLVKIF
GYSPSKVHLIGHSLGAYLAGEAGSRTPGLGRITGLDPTGPDFHNTPNEVR
LDPSDADSVDVIHTNEVRFLFELGVGTINACGHLDFYPNGGKHMPGCEDL
ITPLFKFDLNIYREEMFSFFDCNHARSHCFYAESILNPDAFIAYPCRSYK
SFKAGNCFHCRKEGCPTMGHFADRFHLKKMKSNRSYYFLNTGTLSPFARW
RHKLSVKLDGNNATQGSIFLRVGGTTEKTGEFGVVSGTLKPGMTYTNLID
ADINIGNIASIEFIWKELSFEHSQNKLGAEMVIDISGKYGYESAFCSXNL
VGPNIAQILKPC



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer