Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacvu-r9hgz2

Bacteroides vulgatus dnLKV7. Uncharacterized protein

Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Bacteroides vulgatus dnLKV7
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides vulgatus: N E > Bacteroides vulgatus dnLKV7: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ASSN01000015, WP_016270968
1 UniProt : R9HGZ2
1 UniProt : R9HGZ2
1 Interpro : R9HGZ2
1 Pfam : R9HGZ2
1 PIRSF : R9HGZ2
1 SUPERFAM : R9HGZ2
Sequence
Graphical view for this peptide sequence: bacvu-r9hgz2
Colored MSA for Abhydrolase_7 (raw)
MKKTVICLLLFGIGLTVSAQEKAETVSMRYETQNDMPLFYQKLKESLTYP
MAWRNSSIRNFEKWREGARKVLLDCMQPAPPVAAFDKEVIDTEQRNGYRA
EKILFSVSEYSRVPAYLLVPDGNGPFPAVLLLHDHGAHFSIGKEKMVRPF
GVEASVLADADDWAEKCYDKQYVGDYLASHGYVVLAVDALFWGERGRKEG
VRYDSQQALAANMLQMGMSWGALIAWDDIRSAEFLASLPMVHKEKIGTMG
FSMGAHRAWMVSAATDVVKAGAAVCWMNTTDSLMTLTNNQNKGGSAYSMI
IPGIRNWMDYPHVASIACPKPMLFINGLRDKLFPVKGVESAFSTMQDVWK
SQSVENLLTTKFYDLPHFCSKEIQDDILEFFNQNLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKTVICLLLFGIGLTVSAQEKAETVSMRYETQNDMPLFYQKLKESLTYP
MAWRNSSIRNFEKWREGARKVLLDCMQPAPPVAAFDKEVIDTEQRNGYRA
EKILFSVSEYSRVPAYLLVPDGNGPFPAVLLLHDHGAHFSIGKEKMVRPF
GVEASVLADADDWAEKCYDKQYVGDYLASHGYVVLAVDALFWGERGRKEG
VRYDSQQALAANMLQMGMSWGALIAWDDIRSAEFLASLPMVHKEKIGTMG
FSMGAHRAWMVSAATDVVKAGAAVCWMNTTDSLMTLTNNQNKGGSAYSMI
IPGIRNWMDYPHVASIACPKPMLFINGLRDKLFPVKGVESAFSTMQDVWK
SQSVENLLTTKFYDLPHFCSKEIQDDILEFFNQNLK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer