Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacv8-a6l7p9

Bacteroides vulgatus; Bacteroides dorei; Bacteroides sp.; Bacteroides massiliensis, SusD/RagB-associated esterase-like protein Putative uncharacterized protein

Comment
the family was called first ProteinCluster-CLSK833894 Other strains: Bacteroides vulgatus (ATCC 8482 / DSM 1447 / NCTC 11154) and (Bacteroides dorei (DSM 17855; 5_1_36/D4) Bacteroides sp. (9_1_42FAA; 3_1_33FAA) Bacteroides vulgatus (3975 RP4; 3775 SL(B) 10; CAG:6); Bacteroides massiliensis


Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Bacteroides vulgatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides vulgatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3G8Y: Crystal structure of SusD/RagB-associated esterase-like protein (YP_001301335.1) (BVU_4111) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
No kinetic





No Substrate
No inhibitor
>3 Genbank links 10 more: YP_001301335, WP_012056017, CP000139
>3 UniProt links 1 more: A6L7P9, B6VTL9, C3R7R9
1 Structure : 3G8Y
>3 UniProt links 13 more: A6L7P9, B6VTL9, C3R7R9
>3 Interpro links 13 more: A6L7P9, B6VTL9, C3R7R9
>3 Pfam links 13 more: A6L7P9, B6VTL9, C3R7R9
>3 PIRSF links 13 more: A6L7P9, B6VTL9, C3R7R9
>3 SUPERFAM links 13 more: A6L7P9, B6VTL9, C3R7R9
Sequence
Graphical view for this peptide sequence: bacv8-a6l7p9
Colored MSA for Abhydrolase_7 (raw)
MMIMKRLLFLVSVCSLCMVGNSQNYQPEKHAVVKSDRGDGRLLSTYAIVH
EMLKDTHPQYAYRSGMSAQEFTQWQDGVRAAMVEIMKFPEIKRQPSPVCV
KTEKKEGYILEKWEFYPFPKSVSTFLVLKPEHLKGAVPGVLCIPGSGRTK
EGLVGEPGICDKLTEDYNNPKVSMALNMVKEGYVAVAVDNAAAGEASDLE
CYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDMQVLNWMKAQSYIRKDRI
VISGFSLGTEPMMVLGVLDKDIYAFVYNDFLCQTQERAVVMTKPDKENRR
PFPNSIRHLIPGYWRYFNFPDVVASLAPRPIIFTEGGLDRDFRLVQSAYA
ASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYF
KNELVIPWLRKVLK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMIMKRLLFLVSVCSLCMVGNSQNYQPEKHAVVKSDRGDGRLLSTYAIVH
EMLKDTHPQYAYRSGMSAQEFTQWQDGVRAAMVEIMKFPEIKRQPSPVCV
KTEKKEGYILEKWEFYPFPKSVSTFLVLKPEHLKGAVPGVLCIPGSGRTK
EGLVGEPGICDKLTEDYNNPKVSMALNMVKEGYVAVAVDNAAAGEASDLE
CYDKGWNYDYDVVSRFLLELGWSWLGYTSYLDMQVLNWMKAQSYIRKDRI
VISGFSLGTEPMMVLGVLDKDIYAFVYNDFLCQTQERAVVMTKPDKENRR
PFPNSIRHLIPGYWRYFNFPDVVASLAPRPIIFTEGGLDRDFRLVQSAYA
ASGKPENAEFHHYPKFADKAVRKDVEHLDEGLDSKTYFEAVNVDPPSHYF
KNELVIPWLRKVLK


Reference
    Title: Evolution of symbiotic bacteria in the distal human intestine
    Xu J, Mahowald MA, Ley RE, Lozupone CA, Hamady M, Martens EC, Henrissat B, Coutinho PM, Minx P and Gordon JI <9 more author(s)>
    Ref: PLoS Biol, 5:e156, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer