(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Bacillales: NE > Bacillaceae: NE > Bacillus: NE > Bacillus subtilis group: NE > Bacillus subtilis: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Bacillus subtilis subsp. spizizenii ATCC 6633: N, E.
Bacillus subtilis subsp. spizizenii: N, E.
Bacillus subtilis subsp. natto BEST195: N, E.
Bacillus subtilis subsp. spizizenii str. W23: N, E.
Bacillus subtilis BSn5: N, E.
Bacillus subtilis QH-1: N, E.
Bacillus subtilis QB928: N, E.
Bacillus subtilis subsp. subtilis str. BAB-1: N, E.
Bacillus subtilis BEST7613: N, E.
Bacillus subtilis subsp. subtilis str. SC-8: N, E.
Bacillus subtilis MB73/2: N, E.
Bacillus subtilis BEST7003: N, E.
Bacillus subtilis XF-1: N, E.
Bacillus subtilis subsp. spizizenii TU-B-10: N, E.
Bacillus subtilis subsp. subtilis str. 168: N, E.
Bacillus subtilis subsp. subtilis str. RO-NN-1: N, E.
Bacillus subtilis PY79: N, E.
Bacillus subtilis subsp. subtilis str. BSP1: N, E.
Bacillus subtilis subsp. subtilis 6051-HGW: N, E.
Bacillus subtilis subsp. subtilis str. JH642 substr. AG174: N, E.
Bacillus subtilis subsp. subtilis str. AG1839: N, E.
Bacillus subtilis subsp. subtilis str. OH 131.1: N, E.
Bacillus subtilis E1: N, E.
Bacillus subtilis TO-A: N, E.
Bacillus subtilis Miyagi-4: N, E.
Bacillus subtilis subsp. subtilis: N, E.
Bacillus subtilis subsp. niger: N, E.
Bacillus subtilis subsp. inaquosorum KCTC 13429: N, E.
Bacillus subtilis subsp. globigii: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MFPKPLVILAHEIYGVNSHMKKMGRLIKMAGYDVLTPNLLGEDEVYTLKE EKTAYEQFTKHERLKTGETIIQPVIRQNAGRHIFVIGFSVGATIAWKCSS MPEVSGSVCYYGSRIRDSLHHMPACPVLLFFPNYEPSFDVALLIKKLREK QHTHLEIYQFDALHASPILILFISTGPFSSKRFLS
Bacillus subtilis is the best-characterized member of the Gram-positive bacteria. Its genome of 4,214,810 base pairs comprises 4,100 protein-coding genes. Of these protein-coding genes, 53% are represented once, while a quarter of the genome corresponds to several gene families that have been greatly expanded by gene duplication, the largest family containing 77 putative ATP-binding transport proteins. In addition, a large proportion of the genetic capacity is devoted to the utilization of a variety of carbon sources, including many plant-derived molecules. The identification of five signal peptidase genes, as well as several genes for components of the secretion apparatus, is important given the capacity of Bacillus strains to secrete large amounts of industrially important enzymes. Many of the genes are involved in the synthesis of secondary metabolites, including antibiotics, that are more typically associated with Streptomyces species. The genome contains at least ten prophages or remnants of prophages, indicating that bacteriophage infection has played an important evolutionary role in horizontal gene transfer, in particular in the propagation of bacterial pathogenesis.