Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacpu-w8rkh7

Bacillus pumilus (Bacillus mesentericus) esterase

Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Bacillus pumilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Methyl-3-hydroxy-2-methylpropanoate
No inhibitor
>3 Genbank links 1 more: CP007436, AHL72466, KJ013340
1 UniProt : W8RKH7
1 UniProt : W8RKH7
1 Interpro : W8RKH7
1 Pfam : W8RKH7
1 PIRSF : W8RKH7
1 SUPERFAM : W8RKH7
Sequence
Graphical view for this peptide sequence: bacpu-w8rkh7
Colored MSA for Lipase_2 (raw)
MKVIRFKKKSLQILVALALVLGSMAFIQPKEVKAAAHNPVVMVHGMGGAS
YNFASIKRYLVSQGWDQNQLFAIDFIDKTGNNLNNGPRLSRFVKDVLAKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPG
TDPNQKILYTSVYSSADLIVVNSLSRLIGARNVLIHGVGHIGLLTSSQVK
GYVKEGLNGGGQNTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVIRFKKKSLQILVALALVLGSMAFIQPKEVKAAAHNPVVMVHGMGGAS
YNFASIKRYLVSQGWDQNQLFAIDFIDKTGNNLNNGPRLSRFVKDVLAKT
GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPG
TDPNQKILYTSVYSSADLIVVNSLSRLIGARNVLIHGVGHIGLLTSSQVK
GYVKEGLNGGGQNTN


Reference
    Title: Characterization of an Alkaline Family I.4 Lipase from Bacillus sp. W130-35 Isolated from a Tidal Mud Flat with Broad Substrate Specificity
    Kim HJ, Jung WK, Lee HW, Yoo W, Kim TD, Kim H
    Ref: J Microbiol Biotechnol, 25:2024, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer