(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Bacillales: NE > Bacillaceae: NE > Bacillus: NE > Bacillus pumilus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Bacillus pumilus ATCC 7061: N, E.
Bacillus pumilus SAFR-032: N, E.
Bacillus licheniformis: N, E.
Bacillus licheniformis LMG 7559: N, E.
Bacillus licheniformis ATCC 14580: N, E.
Bacillus licheniformis S 16: N, E.
Bacillus licheniformis WX-02: N, E.
Bacillus licheniformis CG-B52: N, E.
Bacillus licheniformis DSM 13 = ATCC 14580: N, E.
Bacillus sp. B26: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MKVILFKKRSLQILVALALVIGSMAFIQPKEVKAAEHNPVVMVHGIGGAS YNFASIKSYLVGQGWDRNQLYAIDFIDKTGNNRNNGPRLSRFVKDVLDKT GAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTIGGANGLVSSRALPG TDPNQKILYTSVYSSADLIVVNSLSRLIGAKNVLIHGVGHIGLLTSSQVK GYIKEGLNGGGQNTN
References
3 moreTitle: Kinetic studies of Gly28:Ser mutant form of Bacillus pumilus lipase: changes in k(cat) and thermal dependence Bustos-Jaimes I, Mora-Lugo R, Calcagno ML, Farres A Ref: Biochimica & Biophysica Acta, 1804:2222, 2010 : PubMed
Lipases are useful catalysts for a wide variety of industrial purposes. Herein we report the stability and thermal dependence of the activity of wild-type Bacillus pumilus lipase (BplA) and four site-directed mutants designed to improve its thermal stability. The Gly28:Ser mutation produces a dramatic four-fold increase in its k(cat) and a remarkable increase in its stability. While the increase in k(cat) is temperature-independent, the increase in stability shows that the resultant interactions of this mutation have a strong enthalpic component. Thermal dependence of stability, k(cat), K(M) and k(cat)/K(M) were analysed to gain insight on the structural effects of mutations on BplA. Our results are consistent with a gain in enzyme mobility for those mutants displaying enhanced catalytic properties; the analysis of thermal dependence of kinetic parameters indicates that the mutations did not change either the catalytic mechanism or the rate-limiting step of catalysis.
        
Title: Development of a versatile cassette for directional genome walking using cassette ligation-mediated PCR and its application in the cloning of complete lipolytic genes from Bacillus species Nthangeni MB, Ramagoma F, Tlou MG, Litthauer D Ref: J Microbiol Methods, 61:225, 2005 : PubMed
Since the invention of the PCR technology, adaptation techniques to clone DNA fragments flanking the known sequence continue to be developed. We describe a perfectly annealed cassette available in almost unlimited quantities with variable sticky-and blunt-end restriction enzyme recognition sites for efficient restriction and ligation with the restricted target genomic DNA. The cassette provides a 200-bp sequence, which is used to design a variety of cassette-specific primers. The dephosphorylation prevents cassette self-ligation and creates a nick at the cassette: target genome DNA ligation site suppressing unspecific PCR amplifications. We introduce the single-strand amplification PCR (SSA-PCR) technique where a lone known locus-specific primer is firstly used to enrich the targeted template DNA strand resulting in significant PCR product specificity during the second round conventional nested PCR. The distance between the known locus-specific primer and the nearest location of the restriction enzyme used determined the length of the obtained PCR product. We used this technique to walk downstream into the isochorismatase and upstream into the hypothetical conserved genes flanking the mature extracellular lipase gene from Bacillus licheniformis. We further demonstrated the potential of the technique as a cost-effective method during PCR-based prospecting for novel genes by designing "universal" degenerate primers that detected homologues of Family VII bacterial lipolytic genes in Bacillus species. The cassette ligation-mediated PCR was used to clone complete nucleotide sequences encoding functional lipolytic genes from B. licheniformis and Bacillus pumilus.
        
Title: Over-expression and properties of a purified recombinant Bacillus licheniformis lipase: a comparative report on Bacillus lipases. Nthangeni MB, Patterton HG, Van Tonder A, Vergeer WP, Litthauer D Ref: Enzyme Microb Technol, 28:705, 2001 : PubMed
The gene coding for an extracellular lipase of Bacillus licheniformis was cloned using PCR techniques. The sequence corresponding to the mature lipase was subcloned into the pET 20b(+) expression vector to construct a recombinant lipase protein containing 6 histidine residues at the C-terminal. High-level expression of the lipase by Escherichia coli cells harbouring the lipase gene-containing expression vector was observed upon induction with IPTG at 30 degrees C. A one step purification of the recombinant lipase was achieved with Ni-NTA resin. The specific activity of the purified enzyme was 130 units/mg with p-nitrophenyl-palmitate as substrate. The enzyme showed maximum activity at pH 10-11.5 and was remarkably stable at alkaline pH values up to 12. The enzyme was active toward p-nitrophenyl esters of short to long chains fatty acids but with a marked preference for esters with C(6) and C(8) acyl groups. The amino acid sequence of the lipase shows striking similarities to lipases from Bacillus subtilis and Bacillus pumilus. Based on the amino acid identity and biochemical characteristics, we propose that Bacillus lipases be classified into two distinct subfamilies of their own.
        
3 lessTitle: Surface engineering of polyester-degrading enzymes to improve efficiency and tune specificity Biundo A, Ribitsch D, Guebitz GM Ref: Applied Microbiology & Biotechnology, 102:3551, 2018 : PubMed
Certain members of the carboxylesterase superfamily can act at the interface between water and water-insoluble substrates. However, nonnatural bulky polyesters usually are not efficiently hydrolyzed. In the recent years, the potential of enzyme engineering to improve hydrolysis of synthetic polyesters has been demonstrated. Regions on the enzyme surface have been modified by using site-directed mutagenesis in order to tune sorption processes through increased hydrophobicity of the enzyme surface. Such modifications can involve specific amino acid substitutions, addition of binding modules, or truncation of entire domains improving sorption properties and/or dynamics of the enzyme. In this review, we provide a comprehensive overview on different strategies developed in the recent years for enzyme surface engineering to improve the activity of polyester-hydrolyzing enzymes.
The use of biodegradable plastic films made of poly(butylene adipate-co-terephthalate) (PBAT) to improve crop production has been proposed. Because the film after use is expected to be degraded on site, it is important to understand the biodegradation mechanism of PBAT in aerobic and mild temperature conditions. We therefore isolated three PBAT-degrading strains, NKCM3201, NKCM3202, and NKCM3101, from soil environments. Phylogenetic analysis revealed that the strains are closely related to Bacillus pumilus. Strain NKCM3201, which degraded PBAT film at the fastest rate (12.2 mug/day/cm2) and grew well at 30 C to 40 C in aerobic conditions, was selected for further analysis. We cloned the 648-bp coding region of the PBAT hydrolase (PBATHBp) gene, which encodes a 215-amino acid protein containing a signal peptide of 34 residues. Mutation analyses revealed that PBATHBp belongs to the serine hydrolase superfamily, with a catalytic triad composed of Ser77, Asp133, and His156. Homology 3D modeling of PBATHBp using Bacillus subtilis 168 lipase as a template showed that the enzyme belongs to the alpha/beta hydrolase fold family, which lack a lid domain on its surface. PBATHBp hydrolyzed PBAT, poly(butylene succinate-co-adipate) (PBSA), poly(ethylene succinate) (PESu), and polycaprolactone (PCL) films at a degradation rate of 14.3, 3.3 x 10+2, 7.0 x 10+2, and 1.1x 10+2 mug/cm2/day, respectively. Liquid chromatography-mass spectrometry analysis of degradation products from PBAT revealed that PBATHBp hydrolyses ester bonds between butanediol and terephthalate (B-T bonds) at much slower rates than ester bonds between adipate and butanediol. This ester bond preference may explain the very slow PBAT degradation rate compared to PBSA, PESu, and PCL. This is the first report of a PBAT hydrolase from an aerobic mesophilic bacterium, and may contribute to our understanding of PBAT biodegradation under mild temperature conditions.
        
Title: Kinetic studies of Gly28:Ser mutant form of Bacillus pumilus lipase: changes in k(cat) and thermal dependence Bustos-Jaimes I, Mora-Lugo R, Calcagno ML, Farres A Ref: Biochimica & Biophysica Acta, 1804:2222, 2010 : PubMed
Lipases are useful catalysts for a wide variety of industrial purposes. Herein we report the stability and thermal dependence of the activity of wild-type Bacillus pumilus lipase (BplA) and four site-directed mutants designed to improve its thermal stability. The Gly28:Ser mutation produces a dramatic four-fold increase in its k(cat) and a remarkable increase in its stability. While the increase in k(cat) is temperature-independent, the increase in stability shows that the resultant interactions of this mutation have a strong enthalpic component. Thermal dependence of stability, k(cat), K(M) and k(cat)/K(M) were analysed to gain insight on the structural effects of mutations on BplA. Our results are consistent with a gain in enzyme mobility for those mutants displaying enhanced catalytic properties; the analysis of thermal dependence of kinetic parameters indicates that the mutations did not change either the catalytic mechanism or the rate-limiting step of catalysis.
        
Title: Overexpression, purification and characterization of organic solvent stable lipase from Bacillus licheniformis RSP-09 Madan B, Mishra P Ref: J Molecular Microbiology Biotechnol, 17:118, 2009 : PubMed
The lipase gene (543 bp) from Bacillus licheniformis RSP-09, a thermophilic isolate, was overexpressed in Escherichia coli BL21 (DE3). It encodes a polypeptide of 181 residues and has 96% identity with Bacillus pumilus B26 lipase gene. The recombinant lipase was purified 19-fold to electrophoretic homogeneity by His-tag chromatography. The molecular mass of the purified recombinant B. licheniformis RSP-09 lipase was found to be 24 kDa. The purified recombinant B. licheniformis RSP-09 lipase exhibited optimal activity at pH 10.0 and 40 degrees C. The apparent K(m) and V(max) values for pNPP were found to be 453 +/- 118 microM and 288.5 +/- 33.67 micromol min(-1) mg protein(-1), respectively. The purified recombinant lipase had a wide range of substrate specificity and exhibited tolerance to both detergents and organic solvents. Thus, enzyme has potential to be employed in detergents and biocatalysis in nonaqueous solvents.
        
Title: Development of a versatile cassette for directional genome walking using cassette ligation-mediated PCR and its application in the cloning of complete lipolytic genes from Bacillus species Nthangeni MB, Ramagoma F, Tlou MG, Litthauer D Ref: J Microbiol Methods, 61:225, 2005 : PubMed
Since the invention of the PCR technology, adaptation techniques to clone DNA fragments flanking the known sequence continue to be developed. We describe a perfectly annealed cassette available in almost unlimited quantities with variable sticky-and blunt-end restriction enzyme recognition sites for efficient restriction and ligation with the restricted target genomic DNA. The cassette provides a 200-bp sequence, which is used to design a variety of cassette-specific primers. The dephosphorylation prevents cassette self-ligation and creates a nick at the cassette: target genome DNA ligation site suppressing unspecific PCR amplifications. We introduce the single-strand amplification PCR (SSA-PCR) technique where a lone known locus-specific primer is firstly used to enrich the targeted template DNA strand resulting in significant PCR product specificity during the second round conventional nested PCR. The distance between the known locus-specific primer and the nearest location of the restriction enzyme used determined the length of the obtained PCR product. We used this technique to walk downstream into the isochorismatase and upstream into the hypothetical conserved genes flanking the mature extracellular lipase gene from Bacillus licheniformis. We further demonstrated the potential of the technique as a cost-effective method during PCR-based prospecting for novel genes by designing "universal" degenerate primers that detected homologues of Family VII bacterial lipolytic genes in Bacillus species. The cassette ligation-mediated PCR was used to clone complete nucleotide sequences encoding functional lipolytic genes from B. licheniformis and Bacillus pumilus.
        
Title: Over-expression and properties of a purified recombinant Bacillus licheniformis lipase: a comparative report on Bacillus lipases. Nthangeni MB, Patterton HG, Van Tonder A, Vergeer WP, Litthauer D Ref: Enzyme Microb Technol, 28:705, 2001 : PubMed
The gene coding for an extracellular lipase of Bacillus licheniformis was cloned using PCR techniques. The sequence corresponding to the mature lipase was subcloned into the pET 20b(+) expression vector to construct a recombinant lipase protein containing 6 histidine residues at the C-terminal. High-level expression of the lipase by Escherichia coli cells harbouring the lipase gene-containing expression vector was observed upon induction with IPTG at 30 degrees C. A one step purification of the recombinant lipase was achieved with Ni-NTA resin. The specific activity of the purified enzyme was 130 units/mg with p-nitrophenyl-palmitate as substrate. The enzyme showed maximum activity at pH 10-11.5 and was remarkably stable at alkaline pH values up to 12. The enzyme was active toward p-nitrophenyl esters of short to long chains fatty acids but with a marked preference for esters with C(6) and C(8) acyl groups. The amino acid sequence of the lipase shows striking similarities to lipases from Bacillus subtilis and Bacillus pumilus. Based on the amino acid identity and biochemical characteristics, we propose that Bacillus lipases be classified into two distinct subfamilies of their own.