Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacpu-QWF08340

Bacillus pumilus strain SK52.001 feruloyl esterase gene

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Bacillus pumilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus pumilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : MW455110, QWF08340
Sequence
Graphical view for this peptide sequence: bacpu-QWF08340
Colored MSA for Hormone-sensitive_lipase_like (raw)
MNLQEQIKIAASLRQPAEGSLPSQSELKPVHPPEVNKMEYDIPTSAGETK
VWIFKPVNTSKQPLPVFVNLHGGGFILGSAEMDNHWCPVIADRAQCIVVN
VEYQLAPEHPFPAALHECYDVLKWLYEHPDELQIDPNRVAIGGHSAGGNL
ATAACLLNIQKGNPVPIVYQVLDYPPLDLATDPAEKPAFEEAIPVEMARL
FNAFYLQGQDPHNPLVSPIFADRSSLAQLPPALVITAERDSLAQEAEQYA
EKLKEAGVDVTYRQFKGVPHAFTHAGDLEIAEEAWHLMSDQLKKAFE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNLQEQIKIAASLRQPAEGSLPSQSELKPVHPPEVNKMEYDIPTSAGETK
VWIFKPVNTSKQPLPVFVNLHGGGFILGSAEMDNHWCPVIADRAQCIVVN
VEYQLAPEHPFPAALHECYDVLKWLYEHPDELQIDPNRVAIGGHSAGGNL
ATAACLLNIQKGNPVPIVYQVLDYPPLDLATDPAEKPAFEEAIPVEMARL
FNAFYLQGQDPHNPLVSPIFADRSSLAQLPPALVITAERDSLAQEAEQYA
EKLKEAGVDVTYRQFKGVPHAFTHAGDLEIAEEAWHLMSDQLKKAFE


Reference
    Title: Characterization of Feruloyl Esterase from Bacillus pumilus SK52.001 and Its Application in Ferulic Acid Production from De-Starched Wheat Bran
    Duan X, Dai Y, Zhang T
    Ref: Foods, 10:, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer