Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-TGLA

Aspergillus oryzae, Aspergillus flavus triacylglycerol lipase

Comment
Other strains: Aspergillus oryzae, Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC 12722 / SRRC 167) only c term Pfam A Cutinase 81 254


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AB039325, EQ963473, AP007155
3 UniProt : Q9P960, B8N2Q5, Q2UIR7
3 UniProt : Q9P960, B8N2Q5, Q2UIR7
3 Interpro : Q9P960, B8N2Q5, Q2UIR7
3 Pfam : Q9P960, B8N2Q5, Q2UIR7
3 PIRSF : Q9P960, B8N2Q5, Q2UIR7
3 SUPERFAM : Q9P960, B8N2Q5, Q2UIR7
Sequence
Graphical view for this peptide sequence: aspor-TGLA
Colored MSA for Cutinase (raw)
MHLAIKSLFVSLLGASVLASPLPSNALVERNAPLNEFLSALLSHLPAIDG
TIDAVSGVITDFDQLLADLTGARTTQNGYIGVCTDYTVLFARGTSEPGNV
GVLVGPPLSEAFEQAVGAKALSFQGVNGYNADVAGYLAGGDAAGSKSMAS
LASEVLSKCPDTKLVMSGYSQGCQIVHNAVEQLPAADASKISSVLLFGDP
YAGKAFPNVDASRVHTVCHAGDTICNNSVVILPPHLTYAVDVTNAVQFAV
AAAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHLAIKSLFVSLLGASVLASPLPSNALVERNAPLNEFLSALLSHLPAIDG
TIDAVSGVITDFDQLLADLTGARTTQNGYIGVCTDYTVLFARGTSEPGNV
GVLVGPPLSEAFEQAVGAKALSFQGVNGYNADVAGYLAGGDAAGSKSMAS
LASEVLSKCPDTKLVMSGYSQGCQIVHNAVEQLPAADASKISSVLLFGDP
YAGKAFPNVDASRVHTVCHAGDTICNNSVVILPPHLTYAVDVTNAVQFAV
AAAN


References
1 more
    Title: High-level expression and characterization of a stereoselective lipase from Aspergillus oryzae in Pichia pastoris
    Zheng JY, Lan X, Li XJ, Huang LJ, Zhang YJ, Wang Z
    Ref: Protein Expr Purif, 155:1, 2019 : PubMed

            

    Title: Genome sequencing and analysis of Aspergillus oryzae
    Machida M, Asai K, Sano M, Tanaka T, Kumagai T, Terai G, Kusumoto K, Arima T, Akita O and Kikuchi H <54 more author(s)>
    Ref: Nature, 438:1157, 2005 : PubMed

            

    Title: Cloning and sequencing of the triacylglycerol lipase gene of Aspergillus oryzae and its expression in Escherichia coli
    Toida J, Fukuzawa M, Kobayashi G, Ito K, Sekiguchi J
    Ref: FEMS Microbiology Letters, 189:159, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer