Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-faec

Aspergillus fumigatus (Sartorya fumigata) Ferulic acid esterase C faeC, afu2g14530

Comment
Other strains: Aspergillus fumigatus (strain CEA10 / CBS 144.89 / FGSC A1163) (Sartorya fumigata); Aspergillus Neosartorya fumigata


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAHF01000001, DS499595
2 UniProt : A4D9B6, B0XU32
>3 UniProt links 1 more: A4D9B6, B0XU32, A0A0J5PY97
>3 Interpro links 1 more: A4D9B6, B0XU32, A0A0J5PY97
>3 Pfam links 1 more: A4D9B6, B0XU32, A0A0J5PY97
>3 PIRSF links 1 more: A4D9B6, B0XU32, A0A0J5PY97
>3 SUPERFAM links 1 more: A4D9B6, B0XU32, A0A0J5PY97
Sequence
Graphical view for this peptide sequence: aspfu-faec
Colored MSA for FaeC (raw)
MVPTIIYSAILALSAFTPSVFAQTRSSGCGKQPSLANGVHNINGREYILK
VPDNYDKNKAHHLVFGLHWRGGNMWNIVDGQSIQPWYGLETRAQGSAIFV
APNGKNAGWANYGGEDIAFIDAIIKQVESDLCVDQSSRFATGFSWGGGMS
YSLACSRAKQFKAVSVLSGGVISGCDGGNDPIAYLGIHGINDGVLPFQGG
VNLAQKFVRNNGCQQSNVGTPQPGSRGSVRTDFKGCSKPVSFIAYDGGHD
AAPLGVGSSLAPDATWRFFMAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVPTIIYSAILALSAFTPSVFAQTRSSGCGKQPSLANGVHNINGREYILK
VPDNYDKNKAHHLVFGLHWRGGNMWNIVDGQSIQPWYGLETRAQGSAIFV
APNGKNAGWANYGGEDIAFIDAIIKQVESDLCVDQSSRFATGFSWGGGMS
YSLACSRAKQFKAVSVLSGGVISGCDGGNDPIAYLGIHGINDGVLPFQGG
VNLAQKFVRNNGCQQSNVGTPQPGSRGSVRTDFKGCSKPVSFIAYDGGHD
AAPLGVGSSLAPDATWRFFMAA


References
    Title: Identification and characterization of an acetyl xylan esterase from Aspergillus oryzae
    Kato T, Shiono Y, Koseki T
    Ref: J Biosci Bioeng, :, 2021 : PubMed

            

    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer