Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ascra-cutas

Ascochyta rabiei cut gene for cutinase

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Ascochyta rabiei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Pleosporomycetidae: N E > Pleosporales: N E > Pleosporineae: N E > Didymellaceae: N E > Ascochyta: N E > Ascochyta rabiei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : X65628
1 UniProt : P29292
1 Ncbi-nid : 2472
1 Ncbi-pid : 2473
1 UniProt : P29292
1 Interpro : P29292
1 Pfam : P29292
1 PIRSF : P29292
1 SUPERFAM : P29292
Sequence
Graphical view for this peptide sequence: ascra-cutas
Colored MSA for Cutinase (raw)
MKFFAFSMLIGEASPIVLALRRTTLEVRQLDPIIRSELEQGSSSSCPKAI
LIFARGSTEIGNMGVSAGPAVASALEAYGADQIWVQGVGGPYTADLPSNF
LPGGTSQSAINEAVRLFNEANTKCPSTPIVAGGYSQGTAVMAGAIPKLDA
VRARVVGTVLFGYTQNQQNNKGIKDYPQEDLQVYCEVGDLVCDGTLIITV
SHFLYLEEAAGPAPEFLKSKIGA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFFAFSMLIGEASPIVLALRRTTLEVRQLDPIIRSELEQGSSSSCPKAI
LIFARGSTEIGNMGVSAGPAVASALEAYGADQIWVQGVGGPYTADLPSNF
LPGGTSQSAINEAVRLFNEANTKCPSTPIVAGGYSQGTAVMAGAIPKLDA
VRARVVGTVLFGYTQNQQNNKGIKDYPQEDLQVYCEVGDLVCDGTLIITV
SHFLYLEEAAGPAPEFLKSKIGA


Reference
    Title: Acetyl xylan esterase from Trichoderma reesei contains an active-site serine residue and a cellulose-binding domain
    Margolles-Clark E, Tenkanen M, Soderlund H, Penttila M
    Ref: European Journal of Biochemistry, 237:553, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer