Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arcfu-pcbd

Archaeoglobus fulgidus pcbd

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Archaeoglobus fulgidus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Archaeoglobi: N E > Archaeoglobales: N E > Archaeoglobaceae: N E > Archaeoglobus: N E > Archaeoglobus fulgidus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE000986, AE000782
1 Ncbi-nid : 2689309
1 Ncbi-pid : 2648849
1 UniProt : O28567
1 Interpro : O28567
1 Pfam : O28567
1 PIRSF : O28567
1 SUPERFAM : O28567
Sequence
Graphical view for this peptide sequence: arcfu-pcbd
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKKIQAMRFGFFDSDGLKLRYFECGEGEPLILIHGLGDCIEGWTFQYDDF
SKHFRVVALDLRGFGMSDVPESISVEDFARDVKNLIDHLGIERANLLGLS
MGGVVCMEFYRQYPEMVKSLVLANTLHKLPDAGRAMFEQRLKLLESSPDM
TQIAEFIAEMSIHQDRPELKELVKTIIRKNNKEFYTKVTAELGRINYEDL
LPKIEVPTLVITAEFDVTTPPALGREIASLIPKCDIPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKIQAMRFGFFDSDGLKLRYFECGEGEPLILIHGLGDCIEGWTFQYDDF
SKHFRVVALDLRGFGMSDVPESISVEDFARDVKNLIDHLGIERANLLGLS
MGGVVCMEFYRQYPEMVKSLVLANTLHKLPDAGRAMFEQRLKLLESSPDM
TQIAEFIAEMSIHQDRPELKELVKTIIRKNNKEFYTKVTAELGRINYEDL
LPKIEVPTLVITAEFDVTTPPALGREIASLIPKCDIPN


Reference
    Title: The complete genome sequence of the hyperthermophilic, sulphate-reducing archaeon Archaeoglobus fulgidus
    Klenk HP, Clayton RA, Tomb JF, White O, Nelson KE, Ketchum KA, Dodson RJ, Gwinn M, Hickey EK and Venter JC <41 more author(s)>
    Ref: Nature, 390:364, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer