Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-PLA12

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t20m3.6, At1g05800, DONGLE Chloroplast-Localized Galactolipase PLA-Ialpha1

Comment
Chloroplast-Localized Galactolipase. Mutant, dwarf phenotype with round-leaf morphology: dongle means round-shaped in Korean. Sn-1-specific phospholipase that releases free fatty acids from phosphatidylcholine. Has a higher galactolipase activity than phospholipase A1 activity when digalactosyldiacylglycerol (DGDG) is used as substrate. Catalyzes the initial step of jasmonic acid biosynthesis. Regulates leaves growth. Not essential for jasmonate biosynthesis after wounding or upon pathogen infection Strong galactolipase and weak phospholipase


Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: 1-palmitoyl-2-linoleoylphosphatidylcholine, DGDG, MGDG
No inhibitor
2 Genbank : AC009999, EU411040
2 UniProt : D7KF78, Q9MA46
2 UniProt : D7KF78, Q9MA46
2 Interpro : D7KF78, Q9MA46
2 Pfam : D7KF78, Q9MA46
2 PIRSF : D7KF78, Q9MA46
2 SUPERFAM : D7KF78, Q9MA46
1 Tair database : At1g05800
Sequence
Graphical view for this peptide sequence: arath-PLA12
Colored MSA for Plant_phospholipase (raw)
MAAKVFTQNPIYSQSLVRDKTPQQKHNLDHFSISQHTSKRLVVSSSTMSP
PISSSPLSLPSSSSSQAIPPSRAPAVTLPLSRVWREIQGSNNWENLIEPL
SPILQQEITRYGNLLSASYKGFDLNPNSKRYLSCKYGKKNLLKESGIHDP
DGYQVTKYIYATPDINLNPIKNEPNRARWIGYVAVSSDESVKRLGRRDIL
VTFRGTVTNHEWLANLKSSLTPARLDPHNPRPDVKVESGFLGLYTSGESE
SKFGLESCREQLLSEISRLMNKHKGEEISITLAGHSMGSSLAQLLAYDIA
ELGMNQRRDEKPVPVTVFSFAGPRVGNLGFKKRCEELGVKVLRITNVNDP
ITKLPGFLFNENFRSLGGVYELPWSCSCYTHVGVELTLDFFDVQNISCVH
DLETYITLVNRPRCSKLAVNEDNFGGEFLNRTSELMFSKGRRQALHFTNA
ATNAAYLLCSISNHMLYYNIF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAKVFTQNPIYSQSLVRDKTPQQKHNLDHFSISQHTSKRLVVSSSTMSP
PISSSPLSLPSSSSSQAIPPSRAPAVTLPLSRVWREIQGSNNWENLIEPL
SPILQQEITRYGNLLSASYKGFDLNPNSKRYLSCKYGKKNLLKESGIHDP
DGYQVTKYIYATPDINLNPIKNEPNRARWIGYVAVSSDESVKRLGRRDIL
VTFRGTVTNHEWLANLKSSLTPARLDPHNPRPDVKVESGFLGLYTSGESE
SKFGLESCREQLLSEISRLMNKHKGEEISITLAGHSMGSSLAQLLAYDIA
ELGMNQRRDEKPVPVTVFSFAGPRVGNLGFKKRCEELGVKVLRITNVNDP
ITKLPGFLFNENFRSLGGVYELPWSCSCYTHVGVELTLDFFDVQNISCVH
DLETYITLVNRPRCSKLAVNEDNFGGEFLNRTSELMFSKGRRQALHFTNA
ATNAAYLLCSISNHMLYYNIF


References
5 more
    Title: Wound-induced expression of DEFECTIVE IN ANTHER DEHISCENCE1 and DAD1-like lipase genes is mediated by both CORONATINE INSENSITIVE1-dependent and independent pathways in Arabidopsis thaliana
    Rudus I, Terai H, Shimizu T, Kojima H, Hattori K, Nishimori Y, Tsukagoshi H, Kamiya Y, Seo M and Ishiguro S <2 more author(s)>
    Ref: Plant Cell Rep, 33:849, 2014 : PubMed

            

    Title: Enzymatic characterization of class I DAD1-like acylhydrolase members targeted to chloroplast in Arabidopsis
    Seo YS, Kim EY, Kim JH, Kim WT
    Ref: FEBS Letters, 583:2301, 2009 : PubMed

            

    Title: Cooperation and functional diversification of two closely related galactolipase genes for jasmonate biosynthesis
    Hyun Y, Choi S, Hwang HJ, Yu J, Nam SJ, Ko J, Park JY, Seo YS, Kim EY and Lee I <4 more author(s)>
    Ref: Dev Cell, 14:183, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer