Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-PLA11

Arabidopsis thaliana (Mouse-ear cress)Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) T13E15.18 At2g44810 DAD1 DEFECTIVE IN ANTHER DEHISCENCE1 triacyglycerol lipase isolog

Comment
The DEFECTIVE IN ANTHER DEHISCENCE1 DAD1 gene Ishiguro et al. Plant Cell 13:2191-2209(2001)


Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AC002388, AB060156, AC003672
2 UniProt : Q948R1, D7LBS4
2 UniProt : Q948R1, D7LBS4
2 Interpro : Q948R1, D7LBS4
2 Pfam : Q948R1, D7LBS4
2 PIRSF : Q948R1, D7LBS4
2 SUPERFAM : Q948R1, D7LBS4
1 Tair database : At2g44810
Sequence
Graphical view for this peptide sequence: arath-PLA11
Colored MSA for Plant_phospholipase (raw)
MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTC
RFPRSTLLERSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWI
GYVAVCQDKEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTG
ANLNGSNSGPMVESGFLSLYTSGVHSLRDMVREEIARLLQSYGDEPLSVT
ITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPRVGNRCFRKLLEKQ
GTKVLRIVNSDDVITKVPGVVLENREQDNVKMTASIMPSWIQRRVEETPW
VYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRET
ARRVLHR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTC
RFPRSTLLERSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWI
GYVAVCQDKEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTG
ANLNGSNSGPMVESGFLSLYTSGVHSLRDMVREEIARLLQSYGDEPLSVT
ITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPRVGNRCFRKLLEKQ
GTKVLRIVNSDDVITKVPGVVLENREQDNVKMTASIMPSWIQRRVEETPW
VYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRET
ARRVLHR


References
8 more
    Title: On the initiation of jasmonate biosynthesis in wounded leaves
    Kimberlin AN, Holtsclaw RE, Zhang T, Mulaudzi T, Koo AJ
    Ref: Plant Physiol, :, 2022 : PubMed

            

    Title: Wound-induced expression of DEFECTIVE IN ANTHER DEHISCENCE1 and DAD1-like lipase genes is mediated by both CORONATINE INSENSITIVE1-dependent and independent pathways in Arabidopsis thaliana
    Rudus I, Terai H, Shimizu T, Kojima H, Hattori K, Nishimori Y, Tsukagoshi H, Kamiya Y, Seo M and Ishiguro S <2 more author(s)>
    Ref: Plant Cell Rep, 33:849, 2014 : PubMed

            

    Title: Phospholipid-derived signaling mediated by phospholipase A in plants
    Ryu SB
    Ref: Trends Plant Sci, 9:229, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer