Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT5G38220

Arabidopsis thaliana (Mouse-ear cress) ABAPT2 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase

Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AB005247, BT003886, BT004957
1 UniProt : Q9FF34
1 Interpro : Q9FF34
1 Pfam : Q9FF34
1 PIRSF : Q9FF34
1 SUPERFAM : Q9FF34
1 Tair database : AT5G38220
Sequence
Graphical view for this peptide sequence: arath-AT5G38220
Colored MSA for ABHD17-depalmitoylase (raw)
MGGVTSSIAAKFAFFPPSPPSYGFVSDVDRLYITEVPRRDDVDVLKLKTR
RGNEIVAIYIKHPKANGTLLYSHGNAADLGQMFELFIELSNRLRLNLMGY
DYSGYGQSTGKASECNTYADIDAAYTCLKEHYGVKDDQLILYGQSVGSGP
TIDLASRTPNLRGVVLHSPILSGMRVLYPVKRTYWFDIYKNIDKIGAVTC
PVLVIHGTADEVVDCSHGKQLWELSKEKYEPLWVSGGGHCNLELYPEFIK
HLKKYVISISKGPRTGSNKTATTDAAKKQSKPAENGRADTFQLGCCLPEV
SRNSVDSQLEKSKKTSKPEKSRMSIDRFRRKKGSVW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGVTSSIAAKFAFFPPSPPSYGFVSDVDRLYITEVPRRDDVDVLKLKTR
RGNEIVAIYIKHPKANGTLLYSHGNAADLGQMFELFIELSNRLRLNLMGY
DYSGYGQSTGKASECNTYADIDAAYTCLKEHYGVKDDQLILYGQSVGSGP
TIDLASRTPNLRGVVLHSPILSGMRVLYPVKRTYWFDIYKNIDKIGAVTC
PVLVIHGTADEVVDCSHGKQLWELSKEKYEPLWVSGGGHCNLELYPEFIK
HLKKYVISISKGPRTGSNKTATTDAAKKQSKPAENGRADTFQLGCCLPEV
SRNSVDSQLEKSKKTSKPEKSRMSIDRFRRKKGSVW


References
    Title: An ABHD17-like hydrolase screening system to identify de-S-acylation enzymes of protein substrates in plant cells
    Liu X, Li M, Li Y, Chen Z, Zhuge C, Ouyang Y, Zhao Y, Lin Y, Xie Q and Lai J <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones
    Sato S, Kotani H, Nakamura Y, Kaneko T, Asamizu E, Fukami M, Miyajima N, Tabata S
    Ref: DNA Research, 4:215, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer