Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT4G31020

Arabidopsis thaliana (Mouse-ear cress) ABAPT8 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase AT4G31020 F6I18.70

Comment
de-S-acylation of RIN4 (RPM1 Interacting Protein 4) by ABAPT8, results in an increase of cell death in Arabidopsis and Nicotiana benthamiana Liu et al. 2021


Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BT004161, BT005676, AL022198
2 UniProt : Q84JV3, O65548
2 Interpro : Q84JV3, O65548
2 Pfam : Q84JV3, O65548
2 PIRSF : Q84JV3, O65548
2 SUPERFAM : Q84JV3, O65548
1 Tair database : AT4G31020
Sequence
Graphical view for this peptide sequence: arath-AT4G31020
Colored MSA for ABHD17-depalmitoylase (raw)
MGNVTSNVAAKFAFFPPEPATYGVTKDDETGKLVFAGVSADKNVEVHQLT
TKSGNKVVATFWRHPFARFTLLYSHGNAADLGQMVELFIELRAHLRVNIM
SYDYSGYGASTGKPSEFNTYYDIEAVYSCLRSDYGIKQEEIILYGQSVGS
GPTLHMASRLKRLRGVVLHSAILSGIRVLYPVKMTLWFDIFKNIDKIRHV
NSQVLVIHGTNDEIVDLSHGKRLWELAKEKYDPLWVKGGGHCNLETYPEY
IKHLKKFVNAMEKLSLTNPPPKQLTNEPSITETKHNRCLKFGKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNVTSNVAAKFAFFPPEPATYGVTKDDETGKLVFAGVSADKNVEVHQLT
TKSGNKVVATFWRHPFARFTLLYSHGNAADLGQMVELFIELRAHLRVNIM
SYDYSGYGASTGKPSEFNTYYDIEAVYSCLRSDYGIKQEEIILYGQSVGS
GPTLHMASRLKRLRGVVLHSAILSGIRVLYPVKMTLWFDIFKNIDKIRHV
NSQVLVIHGTNDEIVDLSHGKRLWELAKEKYDPLWVKGGGHCNLETYPEY
IKHLKKFVNAMEKLSLTNPPPKQLTNEPSITETKHNRCLKFGKR


References
    Title: An ABHD17-like hydrolase screening system to identify de-S-acylation enzymes of protein substrates in plant cells
    Liu X, Li M, Li Y, Chen Z, Zhuge C, Ouyang Y, Zhao Y, Lin Y, Xie Q and Lai J <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer