Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT4G16820

Arabidopsis thaliana (Mouse-ear cress) (Triacylglycerol lipase like protein) Phospholipase A1-Ibeta2, chloroplastic DAD1-like PLA14 PLA-Ibeta2

Comment
Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position. Has a strong galactolipase activity toward digalactosyldiacylglycerol (DGDG). Hydrolyzes triacylglycerol (TAG), but has a low activity toward phosphatidylcholine (PC) and monogalactosyldiacylglycerol (MGDG)


Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
alpha-linolenic-acid
2 Genbank : Z97342, AL161545
1 UniProt : O23522
1 UniProt : O23522
1 Interpro : O23522
1 Pfam : O23522
1 PIRSF : O23522
1 SUPERFAM : O23522
1 Tair database : AT4G16820
Sequence
Graphical view for this peptide sequence: arath-AT4G16820
Colored MSA for Plant_phospholipase (raw)
MQTLTPNADIFHAKRRRFTCNTHTSTLIPTKPLSVSPARKTNKEHLRNLE
NVLRTSSNSIDHIENVTSRQEKTTKNTSTSSLLGGLNLARIWPQMKAAVD
EMSPKNLKRLQRLLSKSSEERSPKSKLGSKWRELHGLNNWAGLLDPLDEN
LRRELVRYGEFVQAAYHAFHSDPEGSPRHVALPDGSFKVTKSLYATSSVR
LPKWIDDVAPDLRWMTKQTSWVGYVAVCDDPREIRRMGRREIVIALRGTA
TLLEWSENFRPNLVSMPEPKPDQSDPTRPKVECGFNSLYTTGDQHAPSLA
ESLVGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPV
AVFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDKQG
QSRNNGRSPGGIMEMVERNNPWAYSHVGAELRVDMKMSPYLKPNADVACC
HDLEAYLHLVDGFLASNCPFRANAKRSLRKLLDEQRSNVKVLYTGKSLRL
NRTFHDNGDVLPRDTGQGDNPIMKYKLLFRYAVGLSILIITTVFLPIPNF
HTFYFHFLIFISLSFLSLTNQQVLLSTHFVSFILTFSLDLLIIPSMAWSS
H
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTLTPNADIFHAKRRRFTCNTHTSTLIPTKPLSVSPARKTNKEHLRNLE
NVLRTSSNSIDHIENVTSRQEKTTKNTSTSSLLGGLNLARIWPQMKAAVD
EMSPKNLKRLQRLLSKSSEERSPKSKLGSKWRELHGLNNWAGLLDPLDEN
LRRELVRYGEFVQAAYHAFHSDPEGSPRHVALPDGSFKVTKSLYATSSVR
LPKWIDDVAPDLRWMTKQTSWVGYVAVCDDPREIRRMGRREIVIALRGTA
TLLEWSENFRPNLVSMPEPKPDQSDPTRPKVECGFNSLYTTGDQHAPSLA
ESLVGEISRLVELYAGEELSISVTGHSLGAAIALLAADDIAERVPHAPPV
AVFSFGGPRVGNREFADRLDSKGVKVLRVVNSQDVVTKVPGIFADNDKQG
QSRNNGRSPGGIMEMVERNNPWAYSHVGAELRVDMKMSPYLKPNADVACC
HDLEAYLHLVDGFLASNCPFRANAKRSLRKLLDEQRSNVKVLYTGKSLRL
NRTFHDNGDVLPRDTGQGDNPIMKYKLLFRYAVGLSILIITTVFLPIPNF
HTFYFHFLIFISLSFLSLTNQQVLLSTHFVSFILTFSLDLLIIPSMAWSS
H


References
3 more
    Title: Wound-induced expression of DEFECTIVE IN ANTHER DEHISCENCE1 and DAD1-like lipase genes is mediated by both CORONATINE INSENSITIVE1-dependent and independent pathways in Arabidopsis thaliana
    Rudus I, Terai H, Shimizu T, Kojima H, Hattori K, Nishimori Y, Tsukagoshi H, Kamiya Y, Seo M and Ishiguro S <2 more author(s)>
    Ref: Plant Cell Rep, 33:849, 2014 : PubMed

            

    Title: DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation
    Ellinger D, Stingl N, Kubigsteltig, II, Bals T, Juenger M, Pollmann S, Berger S, Schuenemann D, Mueller MJ
    Ref: Plant Physiol, 153:114, 2010 : PubMed

            

    Title: Phospholipid-derived signaling mediated by phospholipase A in plants
    Ryu SB
    Ref: Trends Plant Sci, 9:229, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer