Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT4G16690

Arabidopsis thaliana (Mouse-ear cress) cyanohydrin lyase homolog (cyanohydrin lyase like protein) Methylesterase 16 MES16 AtMES16

Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
1 structure:
5HK8: Crystal structure of a methylesterase protein MES16 from Arabidopsis
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: Z97341, AL161544, CP002687
1 UniProt : O23512
1 Structure : 5HK8
1 UniProt : O23512
1 Interpro : O23512
1 Pfam : O23512
1 PIRSF : O23512
1 SUPERFAM : O23512
1 Tair database : AT4G16690
Sequence
Graphical view for this peptide sequence: arath-AT4G16690
Colored MSA for Hydroxynitrile_lyase (raw)
MGGEGGAEPVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGI
SLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKF
TDKISMAIYLAASMVQPGSIPSPHLSNIHVGEEDIWEYTYGEGTDKPPTG
VLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAEK
VPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTLF
AYLLRAVSFLQR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGEGGAEPVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGI
SLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKF
TDKISMAIYLAASMVQPGSIPSPHLSNIHVGEEDIWEYTYGEGTDKPPTG
VLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAEK
VPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTLF
AYLLRAVSFLQR


References
2 more
    Title: Inactive methyl indole-3-acetic acid ester can be hydrolyzed and activated by several esterases belonging to the AtMES esterase family of Arabidopsis
    Yang Y, Xu R, Ma CJ, Vlot AC, Klessig DF, Pichersky E
    Ref: Plant Physiol, 147:1034, 2008 : PubMed

            

    Title: Characterization and cloning of the chlorophyll-degrading enzyme pheophorbidase from cotyledons of radish
    Suzuki Y, Amano T, Shioi Y
    Ref: Plant Physiol, 140:716, 2006 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer