Gene_locus Report for: aotna-a0a2k5eh28Aotus nancymaae (Ma's night monkey). Pancreatic lipase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Platyrrhini: N E > Aotidae: N E > Aotus: N E > Aotus nancymaae: N E
ABHD8 : aotna-a0a2k5ciy9Aotus nancymaae (Ma's night monkey). Abhydrolase domain containing 8. ABHD10 : aotna-a0a2k5ei86Aotus nancymaae (Ma's night monkey). Abhydrolase domain containing 10. ABHD11-Acetyl_transferase : aotna-a0a2k5cwg3Aotus nancymaae (Ma's night monkey). AB hydrolase-1 domain-containing protein. ABHD13-BEM46 : aotna-a0a2k5e2b6Aotus nancymaae (Ma's night monkey). Hydrolase_4 domain-containing protein. ABHD16 : aotna-a0a2k5cut2Aotus nancymaae (Ma's night monkey). Abhydrolase domain containing 16A. abh_upf0017 : aotna-a0a2k5em92Aotus nancymaae (Ma's night monkey). Hydrolase_4 domain-containing protein. ACHE : aotna-a0a2k5epl8Aotus nancymaae (Ma's night monkey) acetylcholinesterase. Arb2_FAM172A : aotna-a0a2k5eu75Aotus nancymaae (Ma's night monkey). Uncharacterized protein. BCHE : aotna-a0a2k5c5e5Aotus nancymaae (Ma's night monkey) Butyrylcholinesterase. Carb_B_Chordata : aotna-a0a2k5cl83Aotus nancymaae (Ma's night monkey). Carboxylic ester hydrolase, aotna-a0a2k5e9h4Aotus nancymaae (Ma's night monkey). Carboxylic ester hydrolase, aotna-a0a2k5f6h8Aotus nancymaae (Ma's night monkey). Carboxylic ester hydrolase, aotna-a0a2k5f890Aotus nancymaae (Ma's night monkey). Carboxylic ester hydrolase CES2. Cholesterol_esterase : aotna-a0a2k5dan5Aotus nancymaae (Ma's night monkey). Carboxylic ester hydrolase. CMBL : aotna-a0a2k5dtp7Aotus nancymaae (Ma's night monkey). Carboxymethylenebutenolidase homolog. FSH1 : aotna-a0a2k5f8x3Aotus nancymaae (Ma's night monkey). FSH1 domain-containing protein. Hepatic_Lipase : aotna-a0a2k5e885Aotus nancymaae (Ma's night monkey). Lipase C, hepatic type. Lipase_3 : aotna-a0a2k5d786Aotus nancymaae (Ma's night monkey). Uncharacterized protein. Lipoprotein_Lipase : aotna-a0a2k5c9v3Aotus nancymaae (Ma's night monkey). Lipase G, endothelial type. Neuroligin : aotna-a0a2k5bx12Aotus nancymaae (Ma's night monkey).Neuroligin-1, aotna-a0a2k5cdw6Aotus nancymaae (Ma's night monkey). NLGN4X, aotna-a0a2k5cdx4Aotus nancymaae (Ma's night monkey). Neuroligin 4, aotna-a0a2k5cef1Aotus nancymaae (Ma's night monkey). Neuroligin 3, aotna-a0a2k5epz0Aotus nancymaae (Ma's night monkey). Neuroligin 2. Pancreatic_lipase : aotna-a0a2k5cuz8Aotus nancymaae (Ma's night monkey). Pancreatic lipase, aotna-a0a2k5dyb5Aotus nancymaae (Ma's night monkey). Pancreatic lipase, aotna-a0a2k5f3a8Aotus nancymaae (Ma's night monkey). Pancreatic lipase. Phospholipase : aotna-a0a2k5diw6Aotus nancymaae (Ma's night monkey). Phospholipase A1 member A, aotna-a0a2k5e8w4Aotus nancymaae (Ma's night monkey). Lipase H, aotna-a0a2k5esh0Aotus nancymaae (Ma's night monkey). Lipase I. SERHL : aotna-a0a2k5f1e5Aotus nancymaae (Ma's night monkey). Uncharacterized protein. Thyroglobulin : aotna-a0a2k5f0h3Aotus nancymaae (Ma's night monkey). Thyroglobulin
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: aotna-a0a2k5eh28 Colored MSA for Pancreatic_lipase (raw)
MLPRWTLGLLLLATVRGEEVCYEQLGCFSDEKPWTGIVQRPIKLLPWSPK
DIDTRFLLYTNENPDNFQLITGMEPDTIEASNFHLDRKTRFIIHGFLDKG
ENSWLSDMCKNMFKVEKVNCICVDWKGGSRTTYTQAVQNIRVVGAEIALL
IQVLSTQLGYSPEDVHLIGHSLGAHTAAEAGRRLEGRVGRITGLDPAEPC
FQDTPEEVRLDPSDAMFVDVIHTDSAPIVPSLGFGMSQKVGHLDFFPNGG
EQMPGCKKNILSTIVDINGIWEGISGFVACNHLRSYEYYSSSILNPDGFL
GYPCASYNEQNSFFPPLECCFPCCEQTFSLNTGESGNFTNVYEVIRVIYS
ANVTLCVCIFRGSLKPDASHIHDIDVDLNVGKIQKVKFLWNNNVINLFQP
KLGASQITVQTGEDGTEYNFCSSDTVQEDVLQSLYPC
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLPRWTLGLLLLATVRGEEVCYEQLGCFSDEKPWTGIVQRPIKLLPWSPK DIDTRFLLYTNENPDNFQLITGMEPDTIEASNFHLDRKTRFIIHGFLDKG ENSWLSDMCKNMFKVEKVNCICVDWKGGSRTTYTQAVQNIRVVGAEIALL IQVLSTQLGYSPEDVHLIGHSLGAHTAAEAGRRLEGRVGRITGLDPAEPC FQDTPEEVRLDPSDAMFVDVIHTDSAPIVPSLGFGMSQKVGHLDFFPNGG EQMPGCKKNILSTIVDINGIWEGISGFVACNHLRSYEYYSSSILNPDGFL GYPCASYNEQNSFFPPLECCFPCCEQTFSLNTGESGNFTNVYEVIRVIYS ANVTLCVCIFRGSLKPDASHIHDIDVDLNVGKIQKVKFLWNNNVINLFQP KLGASQITVQTGEDGTEYNFCSSDTVQEDVLQSLYPC
|
|
|