Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-nrtac

Anopheles gambiae; Anopheles coluzzii; Anopheles melas; Anopheles merus; Anopheles arabiensis; Anopheles quadriannulatus; CRA_x9P1GAV5CJS neurotactin

Comment
Other strains: Anopheles gambiae; Anopheles coluzzii; Anopheles melas; Anopheles merus; Anopheles arabiensis; Anopheles quadriannulatus


Relationship
Family|Neurotactin
Block| C
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: anoga-nrtac
Colored MSA for Neurotactin (raw)
MGETDEKETAPAATTNDTTKPETPQPTADGPEVEAKETEKLLPEPEPKRS
PVAQAGNPQSKAASSENVANGEEIINIPEEALADGADKDGKKDAAATEQE
PTETGKPDKPNKVQAEEREVKPKKVPAGAFKLPGFFNKNKDKPKEADGAD
NELLEKHGGENGGEAKEKAAAEEGKPGEEKPKRTGGFFANLKLRNPFAKK
PAAADATGETAADKEAGEEEEKDEVTAEATDKPADAEAAGDATEEKKPAA
EGDEPEVQAPKKGLLEALRVPLASIIPKRFKPVPGGEPDDDIELGKTPKN
RAGLASMETLDDSLKDADTKDTVDAKGANGTDGEALVKPDDKEAKDKAAE
AEEDAQERSLLQRVQSYRCSVDDIAIIAGVVIFLILVALIIAFTFVGKSE
PITAPVRDGKYIETVTNCGRVEGILEDGSFAFRGIPYAVPPVGPNRWKAA
QPIESIENCWNGTLKAHNSTPVCWQIYADGKVDGAEDCLTLDVITPHVRY
DNPLPVVVLVGAESFTGDSPGKLRPSTRYARARDVIFVRPNFRLNVFGFL
ALEQLTKSTHPPTSGNYGLTDLIVALKWIQLNIPHFGGDPKSVTLFGHRA
GGTIVTALASSNKTSKLFARTWISSGAAIFPGNPLAESEKENALYMSKIR
CEDSNCLMEKEDEEILDAVPDVWRRTFPDLPAADENATARHEWLVLDGNI
MQQHPADVWSADVSNSVRYVIGSTTHEAHNTKLHLKYTEWTPELVTRHVN
ESVVGRLGLTEEALRRYNATYQGLVAMVSDIRTICPLLTITQKLQSSQFY
VVSQTGGELGIADVDSDVQAILGRYEPKTPEQRRYVSAIQQLFYHYVSHG
EIKHELRKKLLDIGQDALPTYNTDNCLFWIKNDVVPRYARLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGETDEKETAPAATTNDTTKPETPQPTADGPEVEAKETEKLLPEPEPKRS
PVAQAGNPQSKAASSENVANGEEIINIPEEALADGADKDGKKDAAATEQE
PTETGKPDKPNKVQAEEREVKPKKVPAGAFKLPGFFNKNKDKPKEADGAD
NELLEKHGGENGGEAKEKAAAEEGKPGEEKPKRTGGFFANLKLRNPFAKK
PAAADATGETAADKEAGEEEEKDEVTAEATDKPADAEAAGDATEEKKPAA
EGDEPEVQAPKKGLLEALRVPLASIIPKRFKPVPGGEPDDDIELGKTPKN
RAGLASMETLDDSLKDADTKDTVDAKGANGTDGEALVKPDDKEAKDKAAE
AEEDAQERSLLQRVQSYRCSVDDIAIIAGVVIFLILVALIIAFTFVGKSE
PITAPVRDGKYIETVTNCGRVEGILEDGSFAFRGIPYAVPPVGPNRWKAA
QPIESIENCWNGTLKAHNSTPVCWQIYADGKVDGAEDCLTLDVITPHVRY
DNPLPVVVLVGAESFTGDSPGKLRPSTRYARARDVIFVRPNFRLNVFGFL
ALEQLTKSTHPPTSGNYGLTDLIVALKWIQLNIPHFGGDPKSVTLFGHRA
GGTIVTALASSNKTSKLFARTWISSGAAIFPGNPLAESEKENALYMSKIR
CEDSNCLMEKEDEEILDAVPDVWRRTFPDLPAADENATARHEWLVLDGNI
MQQHPADVWSADVSNSVRYVIGSTTHEAHNTKLHLKYTEWTPELVTRHVN
ESVVGRLGLTEEALRRYNATYQGLVAMVSDIRTICPLLTITQKLQSSQFY
VVSQTGGELGIADVDSDVQAILGRYEPKTPEQRRYVSAIQQLFYHYVSHG
EIKHELRKKLLDIGQDALPTYNTDNCLFWIKNDVVPRYARLD


Reference
    Title: The genome sequence of the malaria mosquito Anopheles gambiae
    Holt RA, Subramanian GM, Halpern A, Sutton GG, Charlab R, Nusskern DR, Wincker P, Clark AG, Ribeiro JM and Hoffman SL <113 more author(s)>
    Ref: Science, 298:129, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer