(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Metazoa: NE > Eumetazoa: NE > Bilateria: NE > Protostomia: NE > Ecdysozoa: NE > Panarthropoda: NE > Arthropoda: NE > Mandibulata: NE > Pancrustacea: NE > Hexapoda: NE > Insecta: NE > Dicondylia: NE > Pterygota: NE > Neoptera: NE > Holometabola: NE > Diptera: NE > Nematocera: NE > Culicomorpha: NE > Culicoidea: NE > Culicidae: NE > Culicinae: NE > Aedini: NE > Aedes: NE > Stegomyia: NE > Aedes aegypti: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MEIRGLITRLLGPCHIRHLILCSLGIYSILVQSVHCRHHDIGSSTAHQLG SKYSQSSSLSSSSQSSSSLVEDPVLNKDSDAFFTPYIGHGDSVRIVDAEL GTLEREHVHSTTTRRRGLTRRESSSDGTDNDPLLITTDKGKVRGLTLEAP SGKKVDAWLGIPYAQPPLGPLRFRHPRPVEKWTGVLNATTPPNSCVQIVD TVFGDFPGATMWNPNTPLSEDCLYINVVVPHPRPKNSAVMLWIFGGGFYS GTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQ NLALRWVRDNIHKFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAI LQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLTDTVECLRTKDP NVLVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTDILTGSN TEEGYYFIIYYLTELLRKEEGVTVSREEFLQAVRELNPYVNGAARQAIVF EYTDWTEPENPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLY THRSKGNPWPRWTGVMHGDEINYVFGEPLNSDLGYMEDEKDFSRKIMRYW SNFAKTGNPNPSPPNSDFPEWPKHTAHGRHYLELGLNTTYVGRGPRLRQC AFWKKYLPQLVAATSNLQATPAPSEPCGSSATPYRPLLFLIVSLVLVTCF KI
References
1 moreTitle: Molecular cloning and characterization of the complete acetylcholinesterase gene (Ace1) from the mosquito Aedes aegypti with implications for comparative genome analysis Mori A, Lobo NF, Debruyn B, Severson DW Ref: Insect Biochemistry & Molecular Biology, 37:667, 2007 : PubMed
Insensitive acetylcholinesterase (AChE) has been shown to be responsible for resistance to organophosphates and carbamates in a number of arthropod species. Some arthropod genomes contain a single Ace gene, while others including mosquitoes contain two genes, but only one confers insecticide resistance. Here we report the isolation of the full-length cDNA and characterization of the complete genomic DNA sequence for the Ace1 gene in the yellow fever mosquito, Aedes aegypti. The Ace1 homolog in other mosquito species has been associated with insecticide resistance. The full-length cDNA consists of 2721bp and contains a 2109bp open reading frame that encodes a 702 amino acid protein. The amino acid sequence is highly conserved with that of other mosquitoes, including greater than 90% identity with Culex spp. and about 80% identity with Anopheles gambiae. The genomic DNA sequence includes 138,970bp and consists of eight exons with seven introns ranging from 59 to 114,350bp. Exons 2 and 8 show reduced amino acid conservation across mosquito species, while exons 3-7 are highly conserved. The Ace1 introns in Ae. aegypti reflect a high frequency of repetitive sequences that comprise about 45% of the total intron sequence. The Ace1 locus maps to the p-arm of chromosome 3, which corresponds to the orthologous genome regions in Culex spp. and An. gambiae.
We present a draft sequence of the genome of Aedes aegypti, the primary vector for yellow fever and dengue fever, which at approximately 1376 million base pairs is about 5 times the size of the genome of the malaria vector Anopheles gambiae. Nearly 50% of the Ae. aegypti genome consists of transposable elements. These contribute to a factor of approximately 4 to 6 increase in average gene length and in sizes of intergenic regions relative to An. gambiae and Drosophila melanogaster. Nonetheless, chromosomal synteny is generally maintained among all three insects, although conservation of orthologous gene order is higher (by a factor of approximately 2) between the mosquito species than between either of them and the fruit fly. An increase in genes encoding odorant binding, cytochrome P450, and cuticle domains relative to An. gambiae suggests that members of these protein families underpin some of the biological differences between the two mosquito species.
Title: A novel acetylcholinesterase gene in mosquitoes codes for the insecticide target and is non-homologous to the ace gene Drosophila Weill M, Fort P, Berthomieu A, Dubois MP, Pasteur N, Raymond M Ref: Proc R Soc Lond B Biol Sci, 269:2007, 2002 : PubMed
Acetylcholinesterase (AChE) is the target of two major insecticide families, organophosphates (OPs) and carbamates. AChE insensitivity is a frequent resistance mechanism in insects and responsible mutations in the ace gene were identified in two Diptera, Drosophila melanogaster and Musca domestica. However, for other insects, the ace gene cloned by homology with Drosophila does not code for the insensitive AChE in resistant individuals, indicating the existence of a second ace locus. We identified two AChE loci in the genome of Anopheles gambiae, one (ace-1) being a new locus and the other (ace-2) being homologous to the gene previously described in Drosophila. The gene ace-1 has no obvious homologue in the Drosophila genome and was found in 15 mosquito species investigated. In An. gambiae, ace-1 and ace-2 display 53% similarity at the amino acid level and an overall phylogeny indicates that they probably diverged before the differentiation of insects. Thus, both genes are likely to be present in the majority of insects and the absence of ace-1 in Drosophila is probably due to a secondary loss. In one mosquito (Culex pipiens), ace-1 was found to be tightly linked with insecticide resistance and probably encodes the AChE OP target. These results have important implications for the design of new insecticides, as the target AChE is thus encoded by distinct genes in different insect groups, even within the Diptera: ace-2 in at least the Drosophilidae and Muscidae and ace-1 in at least the Culicidae. Evolutionary scenarios leading to such a peculiar situation are discussed.
Mosquitoes of the Anopheles (An.) and Aedes (Ae.) genus are principal vectors of human diseases including malaria, dengue and yellow fever. Insecticide-based vector control is an established and important way of preventing transmission of such infections. Currently used insecticides can efficiently control mosquito populations, but there are growing concerns about emerging resistance, off-target toxicity and their ability to alter ecosystems. A potential target for the development of insecticides with reduced off-target toxicity is the cholinergic enzyme acetylcholinesterase (AChE). Herein, we report cloning, baculoviral expression and functional characterization of the wild-type AChE genes (ace-1) from An. gambiae and Ae. aegypti, including a naturally occurring insecticide-resistant (G119S) mutant of An. gambiae. Using enzymatic digestion and liquid chromatography-tandem mass spectrometry we found that the secreted proteins were post-translationally modified. The Michaelis-Menten constants and turnover numbers of the mosquito enzymes were lower than those of the orthologous AChEs from Mus musculus and Homo sapiens. We also found that the G119S substitution reduced the turnover rate of substrates and the potency of selected covalent inhibitors. Furthermore, non-covalent inhibitors were less sensitive to the G119S substitution and differentiate the mosquito enzymes from corresponding vertebrate enzymes. Our findings indicate that it may be possible to develop selective non-covalent inhibitors that effectively target both the wild-type and insecticide resistant mutants of mosquito AChE.
Title: Molecular cloning and characterization of the complete acetylcholinesterase gene (Ace1) from the mosquito Aedes aegypti with implications for comparative genome analysis Mori A, Lobo NF, Debruyn B, Severson DW Ref: Insect Biochemistry & Molecular Biology, 37:667, 2007 : PubMed
Insensitive acetylcholinesterase (AChE) has been shown to be responsible for resistance to organophosphates and carbamates in a number of arthropod species. Some arthropod genomes contain a single Ace gene, while others including mosquitoes contain two genes, but only one confers insecticide resistance. Here we report the isolation of the full-length cDNA and characterization of the complete genomic DNA sequence for the Ace1 gene in the yellow fever mosquito, Aedes aegypti. The Ace1 homolog in other mosquito species has been associated with insecticide resistance. The full-length cDNA consists of 2721bp and contains a 2109bp open reading frame that encodes a 702 amino acid protein. The amino acid sequence is highly conserved with that of other mosquitoes, including greater than 90% identity with Culex spp. and about 80% identity with Anopheles gambiae. The genomic DNA sequence includes 138,970bp and consists of eight exons with seven introns ranging from 59 to 114,350bp. Exons 2 and 8 show reduced amino acid conservation across mosquito species, while exons 3-7 are highly conserved. The Ace1 introns in Ae. aegypti reflect a high frequency of repetitive sequences that comprise about 45% of the total intron sequence. The Ace1 locus maps to the p-arm of chromosome 3, which corresponds to the orthologous genome regions in Culex spp. and An. gambiae.
We present a draft sequence of the genome of Aedes aegypti, the primary vector for yellow fever and dengue fever, which at approximately 1376 million base pairs is about 5 times the size of the genome of the malaria vector Anopheles gambiae. Nearly 50% of the Ae. aegypti genome consists of transposable elements. These contribute to a factor of approximately 4 to 6 increase in average gene length and in sizes of intergenic regions relative to An. gambiae and Drosophila melanogaster. Nonetheless, chromosomal synteny is generally maintained among all three insects, although conservation of orthologous gene order is higher (by a factor of approximately 2) between the mosquito species than between either of them and the fruit fly. An increase in genes encoding odorant binding, cytochrome P450, and cuticle domains relative to An. gambiae suggests that members of these protein families underpin some of the biological differences between the two mosquito species.
Title: A novel acetylcholinesterase gene in mosquitoes codes for the insecticide target and is non-homologous to the ace gene Drosophila Weill M, Fort P, Berthomieu A, Dubois MP, Pasteur N, Raymond M Ref: Proc R Soc Lond B Biol Sci, 269:2007, 2002 : PubMed
Acetylcholinesterase (AChE) is the target of two major insecticide families, organophosphates (OPs) and carbamates. AChE insensitivity is a frequent resistance mechanism in insects and responsible mutations in the ace gene were identified in two Diptera, Drosophila melanogaster and Musca domestica. However, for other insects, the ace gene cloned by homology with Drosophila does not code for the insensitive AChE in resistant individuals, indicating the existence of a second ace locus. We identified two AChE loci in the genome of Anopheles gambiae, one (ace-1) being a new locus and the other (ace-2) being homologous to the gene previously described in Drosophila. The gene ace-1 has no obvious homologue in the Drosophila genome and was found in 15 mosquito species investigated. In An. gambiae, ace-1 and ace-2 display 53% similarity at the amino acid level and an overall phylogeny indicates that they probably diverged before the differentiation of insects. Thus, both genes are likely to be present in the majority of insects and the absence of ace-1 in Drosophila is probably due to a secondary loss. In one mosquito (Culex pipiens), ace-1 was found to be tightly linked with insecticide resistance and probably encodes the AChE OP target. These results have important implications for the design of new insecticides, as the target AChE is thus encoded by distinct genes in different insect groups, even within the Diptera: ace-2 in at least the Drosophilidae and Muscidae and ace-1 in at least the Culicidae. Evolutionary scenarios leading to such a peculiar situation are discussed.
