Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acica-elh2

Acinetobacter sp., Acinetobacter soli, Acinetobacter baylyi, elh2 gene catd (beta-ketoadipate enol-lactone hydrolase II)

Comment
Other strains: Acinetobacter sp. ADP1; Acinetobacter soli (NIPH 2899; CIP 110264), Acinetobacter baylyi DSM 14961 = CIP 107474 beta-ketoadipate enol-lactone hydrolase II


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Acinetobacter sp. ADP1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp. ADP1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
3-Oxoadipate-enol-lactone
No inhibitor
>3 Genbank links 2 more: AF009224, CR543861, APPV01000011
2 UniProt : P00632, N9AE59
1 Ncbi-nid : 3025420
1 Ncbi-pid : 2996620
2 UniProt : P00632, N9AE59
2 Interpro : P00632, N9AE59
2 Pfam : P00632, N9AE59
2 PIRSF : P00632, N9AE59
2 SUPERFAM : P00632, N9AE59
Sequence
Graphical view for this peptide sequence: acica-elh2
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MPVFHFKDTLTAQDVALNYATFGQADRPALIFSNSLGTNLSMWQQQIAYF
QDKYFVICYDTRGHGASSTPVGPYRIDQLGTDVIALLDHLQIPQATFCGI
SMGGLTGQWLAIHFPERFNQVIVANTAAKIGEAQAWQARAQLVREQGLTP
IAQTAATRWFTPGFIEDSPEIVEKLSHDLAQGSAEGYASCCEALAEADVR
PQLQRISIPVLVIAGAQDPVTTVADGQFLCEHIVHSTLEVLEASHISNVE
QPQAFNHAVEAVMKRFN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPVFHFKDTLTAQDVALNYATFGQADRPALIFSNSLGTNLSMWQQQIAYF
QDKYFVICYDTRGHGASSTPVGPYRIDQLGTDVIALLDHLQIPQATFCGI
SMGGLTGQWLAIHFPERFNQVIVANTAAKIGEAQAWQARAQLVREQGLTP
IAQTAATRWFTPGFIEDSPEIVEKLSHDLAQGSAEGYASCCEALAEADVR
PQLQRISIPVLVIAGAQDPVTTVADGQFLCEHIVHSTLEVLEASHISNVE
QPQAFNHAVEAVMKRFN


References
7 more
    Title: Characterization of Acinetobacter calcoaceticus catM, a repressor gene homologous in sequence to transcriptional activator genes
    Neidle EL, Hartnett C, Ornston LN
    Ref: Journal of Bacteriology, 171:5410, 1989 : PubMed

            

    Title: DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I structural gene catA: evidence for evolutionary divergence of intradiol dioxygenases by acquisition of DNA sequence repetitions
    Neidle EL, Hartnett C, Bonitz S, Ornston LN
    Ref: Journal of Bacteriology, 170:4874, 1988 : PubMed

            

    Title: Homologous amino acid sequences in enzymes mediating sequential metabolic reactions
    Yeh WK, Davis G, Fletcher P, Ornston LN
    Ref: Journal of Biological Chemistry, 253:4920, 1978 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer