Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9vibr-f9rx95

Vibrio ichthyoenteri ATCC 700023 Uncharacterized protein

Relationship
Family|NLS3-Tex30
Block| X
Position in NCBI Life Tree|Vibrio ichthyoenteri ATCC 700023
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio ichthyoenteri: N E > Vibrio ichthyoenteri ATCC 700023: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AFWF01000012
1 UniProt : F9RX95
1 UniProt : F9RX95
1 Interpro : F9RX95
1 Pfam : F9RX95
1 PIRSF : F9RX95
1 SUPERFAM : F9RX95
Sequence
Graphical view for this peptide sequence: 9vibr-f9rx95
Colored MSA for NLS3-Tex30 (raw)
MTNSVIIDGANNAPLFIFAHGAGAGMDHAFMQQVATGLAAKGIQVVRFNF
PYMVERAENGTKRPPDRAPKLLEAFEQIIAQYADSPVVIGGKSMGGRMAS
LLSDHPQVAAIACLGFPFHPPGKPEKFKGAHLATLTKPCLILQGERDTFG
QREEFDEFDLAPCVRSSFIPDGDHGFKPRKRSGFTEQGNIDLAVERLSQY
IFELYDVAEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNSVIIDGANNAPLFIFAHGAGAGMDHAFMQQVATGLAAKGIQVVRFNF
PYMVERAENGTKRPPDRAPKLLEAFEQIIAQYADSPVVIGGKSMGGRMAS
LLSDHPQVAAIACLGFPFHPPGKPEKFKGAHLATLTKPCLILQGERDTFG
QREEFDEFDLAPCVRSSFIPDGDHGFKPRKRSGFTEQGNIDLAVERLSQY
IFELYDVAEE


Reference
    Title: Vibrio caribbeanicus sp. nov., isolated from the marine sponge Scleritoderma cyanea
    Hoffmann M, Monday SR, Allard MW, Strain EA, Whittaker P, Naum M, McCarthy PJ, Lopez JV, Fischer M, Brown EW
    Ref: Int J Syst Evol Microbiol, 62:1736, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer