Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-f4ck55

Pseudonocardia dioxanivorans CB1190 3-oxoadipate enol-lactonase

Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Pseudonocardia dioxanivorans CB1190
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Pseudonocardia: N E > Pseudonocardia dioxanivorans: N E > Pseudonocardia dioxanivorans CB1190: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002593
1 UniProt : F4CK55
1 UniProt : F4CK55
1 Interpro : F4CK55
1 Pfam : F4CK55
1 PIRSF : F4CK55
1 SUPERFAM : F4CK55
Sequence
Graphical view for this peptide sequence: 9pseu-f4ck55
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAPKTAAVELHHVIDGPPDAPVVVLGPSLGTDVGLFDAQVAALADRWRTI
RFDLRGHGRSPAPPGPYTIAGLAGDVLALVDALGVERFHYAGVSIGGAIG
QWLGIHHADRLLSLTVCASAARFGAPESWPVRAATVRAEGTESMVASRPG
TWFVPKFAQEQPREVERLLAMLRSTSREGYAGCCEAIATYDVREQLGRIT
APTLVVAGAEDPATPVDMVRAIADGVPGSTFVVVPDAAHLVNAERPEPVN
RALAEHLERCAPEQVRVLDSRAARREQLSSPIQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPKTAAVELHHVIDGPPDAPVVVLGPSLGTDVGLFDAQVAALADRWRTI
RFDLRGHGRSPAPPGPYTIAGLAGDVLALVDALGVERFHYAGVSIGGAIG
QWLGIHHADRLLSLTVCASAARFGAPESWPVRAATVRAEGTESMVASRPG
TWFVPKFAQEQPREVERLLAMLRSTSREGYAGCCEAIATYDVREQLGRIT
APTLVVAGAEDPATPVDMVRAIADGVPGSTFVVVPDAAHLVNAERPEPVN
RALAEHLERCAPEQVRVLDSRAARREQLSSPIQG


Reference
    Title: Genome sequence of the 1,4-dioxane-degrading Pseudonocardia dioxanivorans strain CB1190
    Sales CM, Mahendra S, Grostern A, Parales RE, Goodwin LA, Woyke T, Nolan M, Lapidus A, Chertkov O and Alvarez-Cohen L <2 more author(s)>
    Ref: Journal of Bacteriology, 193:4549, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer