Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-PET40

unclassified Amycolatopsis esterase polyethylene terephthalate (PET) hydrolase PETAse PET40

Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|unclassified Amycolatopsis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Amycolatopsis: N E > unclassified Amycolatopsis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
8A2C: The crystal structure of the S178A mutant of PET40, a PETase enzyme from an unclassified Amycolatopsis
No kinetic





No Substrate
No inhibitor
1 Genbank : WAU86704
1 Structure : 8A2C
Sequence
Graphical view for this peptide sequence: 9pseu-PET40
Colored MSA for Polyesterase-lipase-cutinase (raw)
MAENPYERGPAPTTSSIEASRGSFATSTVTVSRLAVSGFGGGTIYYPTST
TAGTFGAISIAPGFTALQSSIAWLGPRLASQGFVVFTIDTLTTSDQPDSR
GRQLLAALDYLTQQSSVRSRIDSSRLGVVGHAMGGGGTLEAARSRPSLQA
AIPLTGWNLTKTWSTVRVPTLVVGAQADTVAPVASHSIPFYNSLPSSLDK
AYLELRGASHFAPNSSNTTIAKYTLSWLKRFIDNDTRYEQFLCPIPSTSL
SISDYRGNCPHNGVDKLAAAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAENPYERGPAPTTSSIEASRGSFATSTVTVSRLAVSGFGGGTIYYPTST
TAGTFGAISIAPGFTALQSSIAWLGPRLASQGFVVFTIDTLTTSDQPDSR
GRQLLAALDYLTQQSSVRSRIDSSRLGVVGHAMGGGGTLEAARSRPSLQA
AIPLTGWNLTKTWSTVRVPTLVVGAQADTVAPVASHSIPFYNSLPSSLDK
AYLELRGASHFAPNSSNTTIAKYTLSWLKRFIDNDTRYEQFLCPIPSTSL
SISDYRGNCPHNGVDKLAAAL


Reference
    Title: The metagenome-derived esterase PET40 is highly promiscuous and hydrolyses polyethylene terephthalate (PET)
    Zhang H, Dierkes RF, Perez-Garcia P, Costanzi E, Dittrich J, Cea PA, Gurschke M, Applegate V, Partus K and Streit WR <5 more author(s)>
    Ref: Febs J, :, 2023 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer