Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9psed-s2jxx1

Pseudomonas plecoglossicida; Pseudomonas sp.; 3-oxoadipate enol-lactonase

Comment
Other strains: Pseudomonas plecoglossicida NB2011; Pseudomonas sp. (VLB120; GM84)


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Pseudomonas plecoglossicida NB2011
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas putida group: N E > Pseudomonas plecoglossicida: N E > Pseudomonas plecoglossicida NB2011: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : ASJX01000087, CP003961, AKJC01000234
2 UniProt : S2JXX1, J3IUJ4
2 UniProt : S2JXX1, J3IUJ4
2 Interpro : S2JXX1, J3IUJ4
2 Pfam : S2JXX1, J3IUJ4
2 PIRSF : S2JXX1, J3IUJ4
2 SUPERFAM : S2JXX1, J3IUJ4
Sequence
Graphical view for this peptide sequence: 9psed-s2jxx1
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAQLQLADGVLNYQIDGPEDAPVLVLSNSLGTDLGMWDSQIPLWSEHLRV
LRYDTRGHGASLVTEGPYSIGQLGRDVLALLDALDIPHAHFVGLSMGGLI
GQWLGIHAGPRLHSLTLCNTAAKIANDEVWNSRIDTVLKGGQQAMADLRD
ASIARWFTPAFAQAQPQQAQRICQMLAQTSPQGYAANCAAVRDADFREQL
NRIQVPTLIVAGTEDAVTTPEHGRFMQANIVGATYAEFPAAHLSNVEVGE
AFSRRVLDFLLAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAQLQLADGVLNYQIDGPEDAPVLVLSNSLGTDLGMWDSQIPLWSEHLRV
LRYDTRGHGASLVTEGPYSIGQLGRDVLALLDALDIPHAHFVGLSMGGLI
GQWLGIHAGPRLHSLTLCNTAAKIANDEVWNSRIDTVLKGGQQAMADLRD
ASIARWFTPAFAQAQPQQAQRICQMLAQTSPQGYAANCAAVRDADFREQL
NRIQVPTLIVAGTEDAVTTPEHGRFMQANIVGATYAEFPAAHLSNVEVGE
AFSRRVLDFLLAR


References
    Title: Engineering of Pseudomonas taiwanensis VLB120 for constitutive solvent tolerance and increased specific styrene epoxidation activity
    Volmer J, Neumann C, Buhler B, Schmid A
    Ref: Applied Environmental Microbiology, 80:6539, 2014 : PubMed

            

    Title: Draft Genome Sequence of Pseudomonas plecoglossicida Strain NB2011, the Causative Agent of White Nodules in Large Yellow Croaker (Larimichthys crocea)
    Mao Z, Li M, Chen J
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Twenty-one genome sequences from Pseudomonas species and 19 genome sequences from diverse bacteria isolated from the rhizosphere and endosphere of Populus deltoides
    Brown SD, Utturkar SM, Klingeman DM, Johnson CM, Martin SL, Land ML, Lu TY, Schadt CW, Doktycz MJ, Pelletier DA
    Ref: Journal of Bacteriology, 194:5991, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer